(data stored in ACNUC7421 zone)

EMBL: CP001600.PE225

CP001600.PE225       Location/Qualifiers
FT   CDS_pept        257690..257803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67494"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD1"
FT                   /protein_id="ACR67494.1"
FT                   /translation="MPKCITLAVFGFEDYEAMEKEQEQMEEISCCRYSGDR"
     atgccaaagt gcatcacgct ggccgttttt ggatttgagg attatgaggc aatggaaaag        60
     gagcaggagc agatggaaga gattagctgc tgtcgttatt caggggatag ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page