(data stored in ACNUC7421 zone)

EMBL: CP001600.PE227

CP001600.PE227       Location/Qualifiers
FT   CDS_pept        complement(258541..259221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0253"
FT                   /product="respiratory nitrate reductase, gamma subunit,
FT                   putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67496"
FT                   /db_xref="GOA:C5BCD3"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD3"
FT                   /protein_id="ACR67496.1"
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSLFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKMILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
     atgtccgcac tgtcctattt tttattcaac atctacccct atatcgccat cacggtgctg        60
     ttgctggggt gcctctaccg gttcgactat ggtcaataca cgtggaaaag cggctcttcg       120
     ctgctgatgg ccaacggacg ctatagccgc tatgcgctca acctgtttca cgtcggtatg       180
     ctgggggttt tcttcggtca cgtggctggg ctactgacgc cgcgctcctg gtatgatgcc       240
     tatatctcca gtcagaccca tcagatcctg gagctgatcg ccggcagcct cttcggcacc       300
     ctgctgctga tcggcgcgct gatgctcttg gcccgccgcc tcttctgcgc ccgggtcgcc       360
     gccacctcgt cgttttccga caagatgatc ctgatcctgt tgacgatcca gatctgcctg       420
     ggcatgctga cgatcccggt cgatctgctg cacccttccg gcgccacgct gcaaaacctg       480
     atcagctgga gccaggggat cgtcaccttc cgtcccgatc cggcccagta tctgcaagag       540
     gtcaactggc tgttcaaggt gcatatggta ctggggctga ccattttcct gatcttcccc       600
     tttacccgtc tggtgcatat ctgcagcctg ccgctgggct atctcctacg gcgacgccag       660
     gtcgttaaaa ccctgcgcta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page