(data stored in ACNUC7421 zone)

EMBL: CP001600.PE229

CP001600.PE229       Location/Qualifiers
FT   CDS_pept        complement(259889..261409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0255"
FT                   /product="nitrate reductase, beta subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67498"
FT                   /db_xref="GOA:C5BCD5"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD5"
FT                   /protein_id="ACR67498.1"
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAIGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQRYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPT
FT                   AAAEADPQALYEAQMKIFLDPGDPDVIAQARRDGISDEILEHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDAGLAEPHDIHLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLSALRHYRRSLLSPQAPQWLQQANLSAPQAEAMYHLLALAPYHERFVIPTG
FT                   MHRPGGDREYIEHGSCGFSFNSPHDTDGANLTGYRPDDRLVISTHSKE"
     atgaaaattc gtgcacaggt ttccatggtg ctaaacctcg ataagtgcat cggttgccac        60
     acctgctcgg tggtgtgcaa aaacgtctgg accagccgcg agggcattga atacggctgg       120
     ttcaacaacg tagaaaccaa gccggggcgc ggctttcccc gtgactggga agatcaggat       180
     aagtggcacg gcggctggca gcgagtcaac ggccagctga cgccgcgcat gggcggcaag       240
     ctcagcctgc tggctaaaat cttcgccaat ccgcatatgc cggcgatagg ggactactat       300
     gaaccctact ccttcgacta cgcgcatttg cacaacgccc ccgccggcgc acgccaccag       360
     ccgacggcgc gcccctattc gctgctcacc ggcaagacgc tggagaaaat tgagggcagc       420
     gccaactggg aggatgacct gggcggcgaa gcccgcgtcc gtcagggcga ccgcaatctg       480
     gatgggctgg acaaacagcg gtatgcccag tttgaacaga ccttcatgat gtacctgccg       540
     cgcttgtgcg aacactgcct taacccggcc tgcgtcgcct cttgccccag cggcgccatc       600
     tataaacggg ccgaagacgg cgtggtgctg atcaatcagg atcagtgccg cggctggcgc       660
     atgtgcgtca gcgcctgccc ctacaagaag atctactaca actggaaaag cgggaaatcg       720
     gagaagtgta tcttctgcta cccgcgcatc gaggccgggc tgccgaccct gtgctccgag       780
     agctgcgtcg gacggatccg ctatatcggc gtcatgctgt acgatgccga ggcgatcccc       840
     accgcggcgg cagaggcgga tccgcaggcg ctgtatgagg cgcagatgaa gatcttcctc       900
     gatcccggcg atccggatgt cattgcgcag gcccgccgcg acggcatcag cgatgagatc       960
     ctggagcatg cccagcgttc gccggtctac cgtctgatta aggagtggcg cctggcgctg      1020
     ccgctgcatc cggagttccg tacgctgccg atggtgtggt acgtgccgcc cctgtcgccg      1080
     atccgcttcg atgacgccgg cctggccgaa ccccacgata tccacctggc ggagctggcg      1140
     cagatgcgta ttccgatcga ctacctggcc aacctgctgt gcgccggtaa ccgtaagccg      1200
     gtagaggcgg cgttgacccg cctgagcgcc ctgcgccact accgccgcag cctgctcagt      1260
     ccgcaggcgc cgcagtggct gcagcaggcc aatctcagcg ctccgcaggc cgaggccatg      1320
     taccaccttc tggcgctggc gccgtaccat gaacgcttcg tgatccccac cgggatgcat      1380
     cgcccgggag gcgatcgcga atatattgag cacggcagct gcggcttcag cttcaattcg      1440
     ccccacgata ccgacggcgc caacctcacc ggctatcgcc ccgacgatcg cctggttatc      1500
     agcacccata gcaaggagta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page