(data stored in ACNUC7421 zone)

EMBL: CP001600.PE23

CP001600.PE23        Location/Qualifiers
FT   CDS_pept        20166..20303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67285"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A5"
FT                   /protein_id="ACR67285.1"
FT                   /translation="MGYVLDEQTFYSWLAAFTRLAAEMNRSNFIACAADVGIKSRASAY
FT                   "
     gtgggctatg tgttggatga acagaccttc tacagctggc tggcggcgtt tacccggctg        60
     gcggcggaaa tgaatcgctc aaattttatt gcatgcgcag cagatgtggg cattaaatca       120
     agggcatcgg cgtattga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page