(data stored in ACNUC7421 zone)

EMBL: CP001600.PE230

CP001600.PE230       Location/Qualifiers
FT   CDS_pept        complement(261436..265107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0256"
FT                   /product="nitrate reductase, alpha subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67499"
FT                   /db_xref="GOA:C5BCD6"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD6"
FT                   /protein_id="ACR67499.1"
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSVGWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRSALRDLWREQKALHPDAVDAWLAILDNPELSQCYKRERGMGGLVRVSW
FT                   QEANELIAASNIATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAI
FT                   SADYAENCKFADEWLAPRAGTDSALALALGQVILQQFYLRQPCDYFVRYAKRFTDFPML
FT                   VMLSPCSGQENTYQSGRYLRAADLAAWREQPLAQWKTLAFDQGSRQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQALDEGEVCVVQPDFSHDNANDRYTYGQVPVHWIT
FT                   TASGECVAVATVFDLMLAHYGLRPRTGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ANNARLTHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDRFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAGAAEGDVRAGVAQALKQGSLRIASEDPDAPGN
FT                   YPRILFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVTWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYIHPFTRAIDPMWEARPDW
FT                   DIFKGIARQFSALCEGHLGKERDVVLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVARDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLYARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIAGLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGKRGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
     atgagtacct ttctgaaaaa gatccgctat ttcaccgcgg gcaagcccat ggccgccaac        60
     gcgcacgagc tgtacctgca ggacagcgtc ggctgggagc agagctaccg cagccgctgg       120
     cagtacgata aggtggtgcg atctacccat ggggtgaact gtaccggctc ctgcagctgg       180
     aaaatctacg ttaaaagcgg gctgattacc tgggagacac agtataccga ctacccggaa       240
     acgcccatcg atctgcccaa tcacgagccg cgcggctgcc cgcgcggcgc cagttactcc       300
     tggtatatct atagcgccaa ccggattaaa tacccgctga tgcgcagtgc gctgcgggat       360
     ctgtggcgtg agcagaaagc gctgcacccc gacgccgtcg acgcctggct agccattctg       420
     gacaaccccg aactgagcca gtgctataag cgtgagcgcg gtatgggcgg cctggtccgc       480
     gtctcatggc aagaggccaa cgaactgatc gcggcatcca atatcgctac cgtcaaacgc       540
     tttggccccg atcgcgtcgc cggattttcg ccgatcccgg ctcatgccat gctctcgttc       600
     gcctccggct cccgctacct gtcgctgatc ggcggcacct gcctgagctt ctacgactgg       660
     tactgcgatc tgccgccctc ctctccgcaa acctggggcg aacagaccga cgtgccggag       720
     tccgccgact ggtataacgc acagtatttg gtgatgtggg gatccaacgt gccgcagacc       780
     cgcacgccgg acgcccactt tatgaccgag gcgcgctaca acggcaccaa ggtggtggcc       840
     atcagcgctg actatgcgga aaactgtaag ttcgccgatg agtggctggc tccgcgggcc       900
     ggcaccgatt ccgcgctggc gctggcatta gggcaggtta ttctgcagca gttttaccta       960
     cggcagccct gcgactactt tgtccgctat gccaaacgct ttaccgattt tccgatgctg      1020
     gtgatgctga gcccctgctc cggccaagag aacacctatc agtccggacg ctacttgcgc      1080
     gccgccgatc tggcggcgtg gcgagagcag ccgctggccc agtggaaaac gctggcattc      1140
     gaccaaggct cacggcagat cgtcattccc cgcggttcgg cgggatttcg ctgggatcag      1200
     gggggacagt ggaataccgt acagcaggat gccctcagcg gcgccgccat cgatccgctg      1260
     ctgagcctgc aggcgctgga tgaaggcgag gtctgcgtcg ttcagcctga cttcagccat      1320
     gacaatgcca acgaccgtta tacctacggt caggtgccgg tgcattggat caccacggcc      1380
     agcggcgagt gcgtcgccgt cgccaccgtc ttcgatctga tgctggccca ctacggcctg      1440
     cgcccgcgca caggggagat ccccgcagaa gatgcgccct gctccccagc ctgggccgag      1500
     gccattaccg gcgtgccgcg ccagcagata atccgtctgg cacaggagtt tgccaacaac      1560
     gcccgcttaa cccatggccg ctcgctgatc atcgtcggcg ccgggatcaa ccactggttc      1620
     catagcgata tgacctaccg cagcatcatc aacgtgctga tgatgtgcgg caccatcggc      1680
     gtcaacggcg gcggctgggc gcactacgtc ggtcaggaaa agctacggcc gctggccggg      1740
     tgggcgccgg tcgccctggc gggagactgg caaagcccgg cgcggctgat gaacggcacc      1800
     tcgttcttct acaatcacac cagccagtgg cgctatgaaa acgtggatgc ccatacgctg      1860
     ctgtcgccgc tggcagagcg tgaccggttc ccccatagcc tgatcgactt caacgtcatc      1920
     gccgaacgcc tgggctggct accctcctcg ccccagctgg atcgcaaccc gctcacgctg      1980
     gccgccgggg cggcggaggg cgatgtcagg gccggggtcg cgcaggcgct gaaacagggc      2040
     tccctacgca tcgccagcga agatcccgac gcaccgggaa actatccgcg catactgttt      2100
     gtctggcgtg ccaacctgct cggttcctcc agtaaaggac atgaatactt tctgaaacac      2160
     ctgttgggca cccgccacgg cgtcatggag caggatctgc agcaaaaggg gctgccgctg      2220
     ccgcagcagg tcacctggcg cgacagcgtc gagggcaagc tggacctgct ggtgacgctc      2280
     gacttcagaa tgtccaccac ctgcctctat tcagacgtga tcctgccgtc ggccacctgg      2340
     tatgagaagg aagacctcag cagtaccgac atgcacccct acattcatcc ctttacccgc      2400
     gctatcgatc ccatgtggga ggcgcgcccg gactgggata ttttcaaagg gatcgcccgg      2460
     cagttctccg cgctgtgcga ggggcatctg ggcaaagagc gcgacgtcgt gctcacgccg      2520
     ctactgcatg actcgccggc agagctgggc caggcctgcg gcgtcagcga ctggaaaaac      2580
     gatccgcaga cctttgtcgc cggaaaaacc gcgcctgcca tcgccgtcgt ggcgcgtgac      2640
     tatccgcaga cctattttaa atatacccac ctcggcccgg cgctggcagc ccacggcaac      2700
     ggcggcaaag gcgtacactg ggacacccgc cccgagatcg acagcctgta cgcgcgtcac      2760
     ggcagcgaga cgctggacgg cgtcggcccc tgtgccaaca tgcaggatgc cacccaggcg      2820
     ttggagacca ttctcaccct ggcaccggaa accaacggcc aggtcgccga tcgcgcctgg      2880
     cgcgatctgg ccgccaaaac cggccagcaa gagatagccg gactggccgc cgacaagaaa      2940
     ggcgtgcact accgtttcgc cgatattcag cgccagccgg gacgggtgat cgccagcccg      3000
     ctgtggtcgg gtatcgacag cgatcggcac gcctacaccg ccggcagcct gaacatcacc      3060
     cacgccgtcc cctggcgcac cctgaccggc cgtcagcagg cctatcagga tcacgcctgg      3120
     atgcaggcct tcggcgaagg cttcgcctgc tataaacccc cgctggatac ccaaagctgc      3180
     cgcagcgtac gcgaacatac agccaacggg cagccggagc tggtactgaa ctttggcacc      3240
     gcccaccaga aatgggggat ccactccacc tataccgaca accagatcat gcagaccctg      3300
     tcgcgcggcg gcccgctgat ctggatcagc gagcacgatg cgcagcgcgg cgccatcgcc      3360
     gacaacgact gggttgagct gtttaacggc aacggcgcca tggtggcgcg ggcggtggtc      3420
     agccagcgca ttcccgccgg gctggcgctg atgtaccacg cccaggagcg tacgctgaac      3480
     atgcccctgt cggaggtcac cgggaaacgc ggtgggatcc acaactccat tacccggatt      3540
     tgtcccaacc cgatccacat gatcggcggc tatgcccacc tgtcatgggg ctacaactat      3600
     tacggcacca tcggctccaa ccgggatgag actgtgatta tccgcaggct gaaccgggtg      3660
     gagtgggact ga                                                          3672
//

If you have problems or comments...

PBIL Back to PBIL home page