(data stored in ACNUC7421 zone)

EMBL: CP001600.PE233

CP001600.PE233       Location/Qualifiers
FT   CDS_pept        complement(267214..267336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67502"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD9"
FT                   /protein_id="ACR67502.1"
FT                   /translation="MIQRTSDLLGYDSAEINKIVFPCVKTIKCELSERHYIVIC"
     ttgatacaga ggacatccga cctcctcggc tatgactctg ctgaaataaa taaaatcgta        60
     tttccatgcg ttaaaacaat aaaatgcgaa ttaagcgagc gtcattatat tgttatttgt       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page