(data stored in ACNUC7421 zone)

EMBL: CP001600.PE239

CP001600.PE239       Location/Qualifiers
FT   CDS_pept        complement(270978..272165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0265"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67508"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE5"
FT                   /protein_id="ACR67508.1"
FT                   /translation="MIKIKIRVSKEIIITALLLFLSGCATTSPPKTAVKKIAPPPVTHE
FT                   RKGYSVQKGTIFLISSSSQYDENVIPEIEMAFSRQCYSVDKRYLNQQPTRLGYVNTDEK
FT                   RAQTLINALSDRNVRYLWFIRGGSGAFNLYPALHAERQHISKSTPKIIIGFSDVTAIHS
FT                   FVNHELNWSSVHGVLASSNKEMHDIDKSKKASMNNSLSEVFETLSHGSHYTGIEPMNSQ
FT                   AVKKVSGKLDGGNMTLVQSLFSTIYEGSYSDKIMMLEDIGVTEKQLDRTLHQIAFSRKF
FT                   HPRAVIFGQFYGQDASDEEKSLYRYVIQQFANLVSYPVYYYPEFGHAETNQPFILNHQV
FT                   NILCSSKYRLCSLTQAPALFMSDPAPKSCAIQKQNSGMRNTPLGGGGTDEKVTIH"
     atgattaaga taaaaataag agtgtcgaaa gaaataataa tcactgccct tttacttttc        60
     ctgtcaggtt gtgcgaccac ctcaccgccc aagaccgctg taaaaaaaat agcccccccg       120
     ccagtaacac atgagcgaaa aggctactct gtccaaaagg ggacaatatt cctgatttcg       180
     agttcatcgc aatatgatga aaacgtcatc cctgagattg agatggcctt ttcccgccag       240
     tgttactcag ttgacaaacg atatctcaac cagcagccta ccaggctggg ttacgtcaac       300
     acggatgaaa aacgggccca gactctcatt aatgctctca gtgacagaaa tgtccgatac       360
     ctctggttta tcagaggcgg ttctggggca ttcaatctat atccagcctt gcatgcagag       420
     cggcagcata tttcaaaatc cacaccgaaa atcatcattg gcttcagtga cgtgacagcc       480
     attcatagct ttgttaatca cgaactaaac tggtcaagcg tgcacggggt gctggcgtct       540
     tctaataaag aaatgcatga tattgataaa agcaaaaaag ccagcatgaa caacagcctg       600
     agtgaagttt ttgagacact atcccatggg agtcattata ctggtatcga gccaatgaat       660
     agtcaggctg taaaaaaagt aagcggtaaa ttagatggtg gaaatatgac tctggtacag       720
     tccctatttt ccactattta tgagggaagc tattccgata aaataatgat gttggaagat       780
     atcggagtga cggaaaaaca gcttgaccgt accttacatc agatagcgtt cagcaggaaa       840
     ttccatccgc gcgccgttat ttttgggcag ttttacggtc aagatgcatc cgacgaagaa       900
     aaatctcttt accgatatgt gatacagcaa ttcgccaatc tggtcagcta ccctgtttat       960
     tactatccgg aatttggaca tgctgaaact aaccagccat tcattttgaa tcaccaggtc      1020
     aatatattat gcagcagcaa ataccggcta tgcagtttga cccaggcacc ggctttgttt      1080
     atgagtgacc ctgccccaaa atcctgcgcc attcagaagc agaattccgg aatgagaaac      1140
     acgcccctgg gcggaggtgg taccgatgaa aaagtcacga ttcactga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page