(data stored in ACNUC7421 zone)

EMBL: CP001600.PE240

CP001600.PE240       Location/Qualifiers
FT   CDS_pept        complement(272552..272851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0266"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67509"
FT                   /db_xref="GOA:C5BCE6"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE6"
FT                   /protein_id="ACR67509.2"
FT                   /translation="MIWVSDPYTKHKVTLMLHTTNPVIKHKTGFPNLAEELSNMEKSYK
FT                   IMDVSRDTFYRSRELADEGGVDALINRSRRAPNSVIRTAIKKRKYSRRIARCVR"
     gtgatatggg tgtcggatcc ttatacaaaa cacaaggtaa ctctcatgct tcatactacc        60
     aatcccgtta tcaaacataa aacaggtttt cccaatctgg ctgaagagct cagcaatatg       120
     gaaaaatcct ataaaatcat ggatgtctca cgtgatacat tttatcgttc tcgcgagctg       180
     gctgatgaag gcggcgtgga tgcattgata aatcgcagcc gtcgcgctcc taacagcgtg       240
     atacggacgg ccatcaagaa acgcaaatat tcccgacgga tagctcggtg cgtaaggtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page