(data stored in ACNUC7421 zone)

EMBL: CP001600.PE241

CP001600.PE241       Location/Qualifiers
FT   CDS_pept        complement(272963..274663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67510"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE7"
FT                   /protein_id="ACR67510.1"
FT                   /translation="MRDTSVNTYARAFSPDKNIKKPVVDEKSSMPTQIAKVVLGILNPG
FT                   IDHEAICLIDKHINRDPKTIGFMDNVRTIHDALSDAVVSDIKEVDVSFSDEFEALTFKE
FT                   KKDDTGNPIVTITYGNHDDNIKGTLASIVRKLEDDFNASPDLYKIGSSYRSLDARLELT
FT                   EIKDMKSEMAMIPAPEIYADDPKNLKAYKISPSTALLMAIKDFPQKNSEISSFLFTGRT
FT                   SENYVSFDKLIVEFCKLHPEYHVATGSTFINRDPVRNYFETQFSFNYLINNLHAIDEGE
FT                   LDALICENMKLLNEDDDILSRTLSGNAIDRDDLIHKEYSDAIANIKVGVGYGGIPLEER
FT                   GKLEKIVKLSFLSVAVAWIKCLPIDIYNTGVYDDDIKGKTIKSNQSHVTSAHMGMMKSY
FT                   HPLPRDDIAYRDKATTFIRPVDQASFSEYAPLVVNVNSKLVHARSNGISGTMLCQARVL
FT                   QYLKEIEAFCFNKTNPLVYIHVLASAMLFNSGGHSYNEFLSPFTLKRVNTRLSSVFDVV
FT                   GEGYRMDSIVSNVGINPSVVDKTLSYFNHLEMKQKLHNELMAKRARVYG"
     atgagagaca catcagtcaa tacctatgct agagcatttt cacctgacaa gaacattaaa        60
     aagcctgtcg tggacgaaaa aagctcaatg cctacacaga tagctaaggt tgtactcgga       120
     atattaaatc cgggaattga tcatgaggct atatgtctta ttgataaaca catcaataga       180
     gatccaaaaa ctataggttt tatggataat gtaagaacaa tacatgatgc gttgtcggat       240
     gctgttgtta gtgacataaa agaggttgat gtctctttta gtgatgaatt tgaagcatta       300
     accttcaaag aaaaaaaaga tgatacaggc aatcctattg taactataac ttacggcaac       360
     catgatgata atatcaaagg cacgctagcg agtattgtga gaaaacttga ggatgacttt       420
     aatgcttctc ctgatttata taaaatagga agcagttata ggtctctgga tgctaggctt       480
     gaattaactg aaattaaaga tatgaaatct gaaatggcta tgattccagc gcctgaaata       540
     tatgctgatg accccaagaa tttaaaagca tataaaatat caccttcaac ggcattgctt       600
     atggcaatca aggatttccc acaaaaaaac agtgagatat cgtcttttct ttttaccggg       660
     agaaccagtg agaattatgt gtcctttgac aagctaatcg ttgaattctg taagttacat       720
     cctgagtatc acgtggcaac gggtagtact tttataaata gagatcccgt gagaaattat       780
     tttgaaactc aattctcatt taattatctt attaataacc tgcatgcgat cgatgagggc       840
     gagcttgatg ctttaatttg tgaaaacatg aaattgttga atgaagacga tgatatattg       900
     tctagaacgt tatccggtaa cgccattgat cgagatgact taatacacaa ggaatattca       960
     gatgcgatag caaatattaa agttggtgta gggtatggtg gaatacccct tgaggaaagg      1020
     ggcaagcttg aaaaaatagt taaactatca tttttgtctg tggccgtagc atggataaaa      1080
     tgtctaccta ttgatatata taataccggt gtctacgatg acgatatcaa ggggaagacg      1140
     ataaagtcga atcagtcaca tgtcacaagt gcgcatatgg gtatgatgaa aagctatcat      1200
     cctttaccac gtgatgatat tgcctataga gataaagcga ccacattcat tcggcctgta      1260
     gaccaagcat catttagtga atatgcaccg ttagttgtca atgttaactc aaaactggtg      1320
     cacgcgcgat caaatggcat atcaggtacg atgctgtgtc aagctagggt attgcaatat      1380
     ctaaaagaaa tagaagcctt ttgttttaat aaaacaaacc ctctagttta tattcatgta      1440
     cttgcctcag ccatgctttt taatagtggt ggacattcgt ataatgagtt tttatctccg      1500
     tttacgttaa aacgggtgaa tactcggcta tctagtgtct tcgatgtcgt gggcgagggc      1560
     tatcgtatgg atagcatcgt aagtaatgtg ggcattaatc cttctgttgt tgataagaca      1620
     ttaagctatt ttaatcactt ggaaatgaag caaaaattac ataacgagtt gatggcgaaa      1680
     agagcacgtg tctatggatg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page