(data stored in ACNUC7421 zone)

EMBL: CP001600.PE243

CP001600.PE243       Location/Qualifiers
FT   CDS_pept        complement(276239..277318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0270"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67512"
FT                   /db_xref="GOA:C5BCE9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCE9"
FT                   /protein_id="ACR67512.1"
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLNPAETLRQAIVT
FT                   TLLMGDDPSSIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFADYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLDMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNTTSRRYAVITAYNGGAGSVLRIFSSDKGQAVNIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNNTQKNYRRIR"
     atgaagaaag tccttgcgct ggcgttaatc gccccgttgt tgatctcatg ttccggcaag        60
     aagcccgata gcaacggtga agaatatata aaagatacca acgggttcga tattctaatg       120
     gggcagtttg cccacaatat cgagaatatc tgggggatta acgaggtgct gatcgccggg       180
     cccaaggact atgtaaaata cagtgaccga tacctgaccc gcagccatat caactttgag       240
     accgggcaga taaccatcga gaccatcgcc acccttaacc cggcggaaac cctgcgtcag       300
     gccatcgtca ctaccctgct gatgggcgac gatcccagct ctatcgatct ctactccgac       360
     gccaacgaca tcaaacccag ccgggagccg ttcctctatg gccaggtgct cgacaacacc       420
     ggtcagccga tccgctggtc tgggcgagcc aacagctttg ccgactatct gctgcagaac       480
     aagctgatga agcggacatc cgggctgcat gtcatctatt ccgtcaccat tcagctggtg       540
     cccaaccacc tggacaagcg ggcgcacaaa tatctggaca tggtacggcg tgcctcagag       600
     cgctatggcg tcgacgagtc gctgatcctg gccatcatgc agacggagtc cagctttaac       660
     ccctatgccg tcagccgctc cgacgcgctg gggctgatgc aggtaatgca gcacaccgcc       720
     ggcaaggatg tgtttgtctc caaaggcaag tggggtaccc ccagccgcag ctatctgttt       780
     gacccggaga aaaacattga taccggcacc gcctatctgg ctatcctgca gaacacctat       840
     ctgggcggga tccagaacac cacctcacgc cgctacgcgg tgatcaccgc ctataacggc       900
     ggcgccggca gcgtgctgcg catcttctcc agcgataaag gacaggcggt caacatcatc       960
     aaccagatgt cgcccggcga tgtgtatgag gcgctgaccc agcgtcaccc gtccgccgag      1020
     tcgcgtcgct atctgtataa ggtcaacaac acgcagaaaa actaccgccg catccgctaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page