(data stored in ACNUC7421 zone)

EMBL: CP001600.PE244

CP001600.PE244       Location/Qualifiers
FT   CDS_pept        complement(277366..277638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0271"
FT                   /product="Protein of unknown function (DUF495)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67513"
FT                   /db_xref="GOA:C5BCF0"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCF0"
FT                   /protein_id="ACR67513.1"
FT                   /translation="MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAK
FT                   QTMLINEKKLNMMNPDDRSLLAREMEKFLFEGHDVHIEGYTPPNQ"
     atgagcagaa ccgtgttttg tacgttcctc aaccgtgagg ccgaggggct ggactttcaa        60
     agctaccccg gcgatctggg caagcgcatc tatgatcaca tctccaaaga ggcctggggt       120
     cagtggatgg ccaagcaaac catgctgatc aacgaaaaga aactgaatat gatgaacccg       180
     gatgaccgta gtctgctggc ccgggagatg gagaaatttc tgttcgaggg ccacgacgtc       240
     cacatcgaag gctatacgcc accgaatcag taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page