(data stored in ACNUC7421 zone)

EMBL: CP001600.PE247

CP001600.PE247       Location/Qualifiers
FT   CDS_pept        279735..280061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0274"
FT                   /product="Protein with unknown function (DUF469)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67516"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR0"
FT                   /protein_id="ACR67516.1"
FT                   /translation="MAKNRSRRLRKKLHIDEFQEVGFSASWRFAEGTPVETVDALLDRL
FT                   IDEVIEPNGLAFDGSGYLRWEGLICLQQIGRCTDEQRQLVKGWLESQGMLDVVVSDLFD
FT                   VWWE"
     atggcaaaaa atcgtagtcg tcgtctgcgc aaaaagctgc atattgacga gtttcaggaa        60
     gtgggcttca gcgccagctg gcgttttgcc gagggtacgc cggtagagac ggtggacgcg       120
     ctgctcgatc gtctgatcga tgaggtgatc gagccgaatg gtctggcgtt tgatggtagc       180
     ggctatttgc gctgggaagg gttgatctgc ctgcagcaga ttggccgctg caccgatgaa       240
     cagcgtcagc tggtgaaagg ctggctggaa agccagggta tgctggacgt tgtggtcagc       300
     gacctgtttg atgtgtggtg ggagtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page