(data stored in ACNUC7421 zone)

EMBL: CP001600.PE249

CP001600.PE249       Location/Qualifiers
FT   CDS_pept        281197..281925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0276"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67518"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR2"
FT                   /protein_id="ACR67518.1"
FT                   /translation="MGKWGCSLLLLLATAQVQAAWQCQVKPQDDIIISAQQVQIVGASG
FT                   NLQISRDGAVTRDGHPLALSADARRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDNI
FT                   IVEQLGSDSNVRNRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQTL
FT                   GGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRSEWDKQDNDLRAFGQQAC
FT                   ERVQALDSQRKALLKALPAS"
     atgggtaaat ggggatgctc cctgctgttg ctgctggcca ccgcacaggt gcaggccgcc        60
     tggcagtgcc aggttaaacc gcaggacgat atcattatca gcgcgcagca ggtacagatc       120
     gtcggcgcca gcggcaatct gcagatatcc cgcgacggtg cggtgacgcg tgacggccat       180
     ccgctggcgc tgagcgccga cgcccgccgt caggccgaga cgctgcagcg ggatctgcgg       240
     cgcgatgtgc cgtggatcga ccaaggggtg cagacgcgcc tggatcgtgc gcgtggcgcg       300
     ctggacaata tcatcgtcga gcagctgggc agtgacagca acgtacgcaa tcgtctgagt       360
     acgctggata cccagcttaa ggcgcagatg aatcgggtgc tggagaaacg cagtgacggt       420
     tacgccttcc accatcaggc gattgcccag gtcgagaaag agggtcagac attggtgaac       480
     cagaccctgg gcggcgtgct gcaggacagc atcaatgaga tgggggccaa ggggctgctg       540
     aaggcgggtc agtcggagaa tccgctgcag gcggtgttgg gcaacctcgg cggtctgcag       600
     cagtctatcc gcagcgagtg ggataagcag gataatgatc tgcgcgcctt cggccagcag       660
     gcctgtgagc gagtacaggc gctggacagc cagcgtaagg ccttgctgaa ggcgctgccc       720
     gcctcctga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page