(data stored in ACNUC7421 zone)

EMBL: CP001600.PE250

CP001600.PE250       Location/Qualifiers
FT   CDS_pept        282053..283672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0278"
FT                   /product="periplasmic oligopeptide-binding protein
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67520"
FT                   /db_xref="GOA:C5BCR3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR3"
FT                   /protein_id="ACR67520.1"
FT                   /translation="MNIKYNLFLGYGLFMLIFGMGPSGGALAASVAPGVTLAAGQTLTR
FT                   NNGSEPASLDPHKSESDVEFNIINDFFEGLVTMGPDGHIRPGLAERWENSEDGRIWRLY
FT                   LRPGLQWSNGEPLTARDVVFSWQRQVDPATASPYGSYLANMHLENAIQIQAGQQPPEAL
FT                   GIRAVDDVTLQITLTRPLSTFLSMLVHPSLMTVNPRVIARFGDKWTQPGNFVSSGAYTL
FT                   QRWVVNERLEGVRNPRYWDNAHTVINQVTYLPIVSETADVNRYKAGEIDITASVPSPQF
FT                   AALRRELGEQVHIAPKLATYYYYFNTRKPPFDDPRVRLALNLGLDKDVIADKVLGQGQR
FT                   PAWLFSAGKIGGMTLLPPEYAAWPREQRLARARALLTEAGFGPDSPLHFTLLYNTSEGH
FT                   QRIAIAASSMWKKNLGVEAALNNQEWKTMLDTMRSGNFDLVRSGWVADYDDPSAFLNTF
FT                   RSADSNNTPQYVNPRYDALLAGAADSQDPEKRQQLFQQAETILAAEVPAIPLYHYVSVR
FT                   LVKPHVGGFRAANKTVQQSASR"
     atgaatatta aatataattt atttttagga tatggactgt ttatgctcat ctttgggatg        60
     gggccctccg gaggggcact ggcggccagt gtggcgccgg gtgtgaccct ggccgccggg       120
     cagacactga cgcgcaataa cggcagtgag ccggcatcgc tcgatcctca taaatcagaa       180
     agtgatgttg aattcaatat tatcaatgat ttctttgagg ggttggtgac gatgggccct       240
     gatggtcaca ttcgtcccgg actggctgaa cgctgggaaa acagtgagga cgggcggata       300
     tggcggctgt atctgcgccc cggtctgcag tggtcgaacg gggagcccct gacggcccga       360
     gatgtggtat tcagctggca gcggcaggtc gatccggcga cggcctcacc ctatggcagc       420
     tatctggcga acatgcatct ggagaatgcc attcagatcc aggccgggca gcagccaccg       480
     gaagcgctgg ggatccgggc cgtggatgat gtcaccctgc agataaccct gacccgtccc       540
     ctgtcgactt ttctgtcgat gctggtgcac ccgtcgctga tgacggtgaa tccacgggtg       600
     attgcacgtt ttggcgataa atggacccag ccgggcaact ttgtcagcag cggagcctat       660
     acgctgcagc gctgggtggt caatgagcgg ctggaggggg tgcgaaatcc ccgttactgg       720
     gataatgccc atacggtgat caatcaggtc acctatttac ccatcgtttc tgaaacggct       780
     gatgttaacc gctataaggc cggtgaaatc gacattaccg cctcggtgcc cagtccacag       840
     tttgcagccc tgcgtcgcga gttgggtgaa caggtacaca tcgctcccaa actggccacc       900
     tactactatt acttcaatac ccgtaagccc ccttttgatg atccccgggt gcggttggcg       960
     ctgaatctgg ggctggataa ggacgtgatt gccgataagg tgctggggca ggggcagcgc      1020
     cccgcctggc ttttcagtgc cggaaagatc ggcgggatga cgctcctgcc gccggagtat      1080
     gccgcctggc cgcgtgagca gcgcctggcc cgggctcggg ccctgctgac agaggcgggt      1140
     tttggcccgg actccccgtt gcactttacc ctgctgtaca acacctccga ggggcatcag      1200
     cgcatcgcca ttgccgccag ctcgatgtgg aagaaaaatt tgggggtgga ggcggcgctg      1260
     aacaatcagg agtggaagac catgctggat accatgcgca gcgggaattt tgacttggtg      1320
     cgcagtggct gggtggcgga ctatgacgat ccctctgcct ttctgaacac ctttcgcagc      1380
     gctgacagca ataacacgcc gcagtatgtc aacccgcgtt atgacgccct gctggctggt      1440
     gcggcggaca gtcaggatcc cgaaaaacgc cagcagctgt ttcagcaggc tgagacgatc      1500
     ctggccgcag aggttccggc catcccgctg taccattatg tcagcgtacg gctggtgaag      1560
     ccccatgtcg gcgggtttag agccgctaac aaaaccgttc aacaaagcgc aagcagataa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page