(data stored in ACNUC7421 zone)

EMBL: CP001600.PE251

CP001600.PE251       Location/Qualifiers
FT   CDS_pept        complement(283638..284039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0277"
FT                   /product="transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67519"
FT                   /db_xref="GOA:C5BG24"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5BG24"
FT                   /protein_id="ACR67519.2"
FT                   /translation="MERQGIPLAVLVSGANRHDSIMFEPLLDALPALAGKRGRPRYRPD
FT                   KLHADKGYDFRRCRDYLRRRGIKARIARRGIDSNDRLGRYRWVVERTHGWLAGFGKLRI
FT                   RFERRLDTHLALLTLACAVICLRFVERFC"
     gtggaacgcc agggcatacc actcgccgtg cttgtctctg gagccaatcg ccatgactcg        60
     ataatgtttg agccattgtt ggatgccctc ccggcgttag caggcaagag aggacgacca       120
     cgatatcggc ctgacaagct acacgcagac aaggggtatg attttcgccg ttgccgggat       180
     tatctgaggc ggcggggaat caaggctcgt attgcccggc gaggcattga tagcaatgac       240
     cgcttgggtc gttatcgctg ggttgtagag cgaactcatg gttggttagc gggttttggc       300
     aagctgcgta ttcgcttcga acggcggctg gatacccatc ttgccttgct gacgctggct       360
     tgtgctgtta tctgcttgcg ctttgttgaa cggttttgtt ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page