(data stored in ACNUC7421 zone)

EMBL: CP001600.PE254

CP001600.PE254       Location/Qualifiers
FT   CDS_pept        complement(286404..286694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0281"
FT                   /product="conserved hypothetical protein TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67523"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCR7"
FT                   /protein_id="ACR67523.1"
FT                   /translation="MSAVSREGDDWILRLYIQPKASRDLIIGLHGDELKVAITAPPVDG
FT                   QANAHLLKFIAKQFRVAKSRITLEKGELGRHKQLRISQPQQIPDAVAAALG"
     gtgagtgcag tcagtcggga gggcgacgac tggatcctgc ggctgtatat tcagccgaag        60
     gccagccggg atctcatcat tgggctgcac ggcgatgagc tgaaggtcgc catcaccgcc       120
     ccgccggtcg atggtcaggc taacgcccac ctgctaaaat tcatcgccaa acagtttcgc       180
     gtcgccaaaa gccgcatcac gctggaaaag ggcgagctgg gacgccataa acagctgcgc       240
     atcagccagc cgcagcagat ccccgacgcg gtagcggcag cgctcggata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page