(data stored in ACNUC7421 zone)

EMBL: CP001600.PE255

CP001600.PE255       Location/Qualifiers
FT   CDS_pept        complement(286691..287245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0282"
FT                   /product="YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67524"
FT                   /db_xref="GOA:C5BCR8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR8"
FT                   /protein_id="ACR67524.1"
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLSEPLMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
     atgctaacac tgacgttttt ggtcaaaacg ctgctcgatc tgtatgtgat ggtgctgctg        60
     ctgcgcatct ggatgcagtg ggcgcgcagc gatttctaca acccgctttc gcagtttatc       120
     gtgaagctga cccagccggt ggtggcgccg ctgcgccgca ttctgccgcc gctggggccg       180
     atcgactccg cctcgctgct gctggccttc atcctgatga ccgtcaaata cccgctgcta       240
     ctgctgatcc agagcggctc cctctccctc agcccctata acctgctgtt tggtctgata       300
     tcggtggtca agtccgccgg ttatctggtg ttctgggtga tcatcatccg ttcgatcatg       360
     agctggatta gccaggggcg cagcccgatg gactatgtcc tctaccagct gagcgagccg       420
     ctgatggcgc cgatccgtcg catcatcccg gcaatgggcg gactggattt ctccgccatg       480
     gtggtgatcc tggtactgta cctgctcaac tacctgggca tcgatctgtt cggccagcta       540
     tggttcctgc tgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page