(data stored in ACNUC7421 zone)

EMBL: CP001600.PE256

CP001600.PE256       Location/Qualifiers
FT   CDS_pept        complement(287351..288061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0283"
FT                   /product="alanine racemase, N-terminal domain protein"
FT                   /note="alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67525"
FT                   /db_xref="GOA:C5BCR9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR9"
FT                   /protein_id="ACR67525.1"
FT                   /translation="MNTTIKHNLDAVRQHIARAAEQCGRHPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAQLKPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
     atgaacacca ccatcaaaca caatcttgac gcggtccgtc agcacattgc ccgcgcggca        60
     gaacagtgcg ggcgccaccc gcgggacatt accctgctgg ccgtcagcaa gaccaagccc       120
     attgaggaca tcgatgccgc tatcgccgct gggcagcgcg cctttggcga aaactatgtg       180
     caggagggcg tcagtaaaat ccagcactac cgccagcagc cgcagggcga cgcgctggag       240
     tggcacttta tcgggccgct gcagtctaac aaaagccgcc cggtggccga gcattttgat       300
     tggatccaca ccgtcgatcg tgtgaaaatt gcccagcggt taaacgaaca gcgtccggcg       360
     cagcttaagc cgcttaacgt attgattcaa gtgaatatca gcgatgagca gagcaagtcc       420
     ggcatcacgc tggagcagat cgatgcgctg gccgacgcca tcagtcagct accccgcctg       480
     cgcctgcgcg gcctgatggc cattccggcg ccggaggacg atccggcccg ccagctagcg       540
     gtctgtaccc gcatggcgca ggcgctgtct gccctgcagc ggcgctatcc ccagctggat       600
     accttgtcgt tggggatgac ccatgatatg gaggccgcca ttacggccgg cagtaccctg       660
     gtacgcatcg gtaccgccat tttcggcgcc cgcgactacg gcacggccta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page