(data stored in ACNUC7421 zone)

EMBL: CP001600.PE257

CP001600.PE257       Location/Qualifiers
FT   CDS_pept        complement(288246..288668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0284"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67526"
FT                   /db_xref="GOA:C5BCS0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCS0"
FT                   /protein_id="ACR67526.1"
FT                   /translation="MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGVPDWQQ
FT                   IEKVLREWQPDLVVVGLPLNMDGSEQPLTQQARKFANRLHGRFGVQIALQDERLSTVEA
FT                   RAHLFAGGGYRALEKGRVDAASAALILESWFENQYR"
     atgaatcccc gtactattct cgccttcgac ttcggcaccc gcagcatcgg ctgcgccatc        60
     gggcaggagc tgaccggcag cgcccgcccg ttgcaatcct tcaaggccaa cgacggcgtc       120
     cccgactggc agcagataga gaaagtactg cgtgaatggc agccggatct ggtggtggtc       180
     ggcctgccgc tgaacatgga cggcagcgaa cagcccctga cccaacaggc ccgcaagttt       240
     gccaaccgcc tgcatggccg ctttggggta cagatagcgc tgcaggatga gcgtctgagc       300
     acagtggagg cccgtgccca cctgtttgcc ggcggcggct atcgcgcgct ggagaaaggc       360
     cgcgtcgacg ccgcctctgc cgccctgatt ttggagagct ggttcgaaaa tcagtaccgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page