(data stored in ACNUC7421 zone)

EMBL: CP001600.PE258

CP001600.PE258       Location/Qualifiers
FT   CDS_pept        complement(288668..289201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0285"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, COG1678"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67527"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS1"
FT                   /protein_id="ACR67527.1"
FT                   /translation="MPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQLTLSSLLEKL
FT                   DITPSPRDATIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCMLTTSRDVLET
FT                   LGTDRQPQEILVTLGYCSWSKGQLEQELLDNTWLTVEADSQILFHTPLAERWIGAAKKL
FT                   GVDIRNMPCNAGHA"
     atgcccgcca tgcaggacag tcgctttaaa cgcaccgtca tctatgtgtg cgaacacaat        60
     gaggatggcg ccatgggcat gatcatcaat aaacccctgg agcagctcac gctgtccagc       120
     ctgctggaaa agctcgacat taccccctcc ccgcgcgacg ccactatccg cctggacaag       180
     ccggtgctgg ccggcggtcc gctggcggag gatcgcggtt ttgtcctgca cagcccgacg       240
     gatacctttg gctccagcgc cgacattggc ccgggctgta tgcttaccac ctcgcgcgat       300
     gtgctggaga ccctgggcac cgaccgccaa ccgcaggaga ttctggttac cctgggctac       360
     tgcagctgga gcaaagggca gctggagcaa gaactgctgg acaatacctg gctcacggta       420
     gaggccgaca gtcagatcct atttcacacc ccgctggccg agcgctggat tggcgcggcg       480
     aaaaagctgg gggtcgatat ccgtaatatg ccttgtaacg caggacacgc ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page