(data stored in ACNUC7421 zone)

EMBL: CP001600.PE260

CP001600.PE260       Location/Qualifiers
FT   CDS_pept        complement(290446..291177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0287"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67529"
FT                   /db_xref="GOA:C5BCS3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS3"
FT                   /protein_id="ACR67529.1"
FT                   /translation="MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDG
FT                   SNRVFDAEIVSADKKNVRVRLDGVREEDSESPLHLHLGQVMSRGEKMEFTIQKSIELGV
FT                   SVITPLISERCGVRLDAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPIMTLEAWCAEP
FT                   DDGLRLNLHPRASASINTLPLPQHRIRLLIGPEGGLSADEIAMTANHRFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
     atgcgcattc cccgtattta ccacccacag cccctgagca ttcccggcga agtcagcctg        60
     tgcgacgatg ccgccaacca cgttggtcgg gtactgcgca tgggacccgg ccaggccctg       120
     cagctgttcg atggcagtaa ccgggtcttc gatgccgaga tagtcagcgc agataaaaaa       180
     aacgtgcgcg tgcgccttga tggcgtgcgg gaagaggaca gtgaatcacc gctgcacctg       240
     catctgggcc aggtgatgtc gcgcggtgaa aagatggagt ttaccatcca gaagtcgatt       300
     gagctggggg tcagcgtgat tacgccgctg atctccgaac gctgtggagt gcgtctggac       360
     gccgagcgga tggccaaaaa acagcagcaa tggcagaaaa tcgccatcgc cgcctgcgag       420
     cagtgcgggc gcaaccgcat tccccagatc cgtccgataa tgacgctgga agcatggtgc       480
     gccgagccgg atgatggtct gcgtctcaac cttcacccgc gcgccagtgc cagcatcaac       540
     accctgcccc taccgcaaca ccgtatccgc ctgctgatag gcccggaggg cggcctgtcg       600
     gcagacgaga ttgccatgac tgccaatcac cgctttactg atatcctatt ggggccgcgc       660
     gtactgcgca ccgagacgac ggcgctaacc gccatcaccg cacttcaggt ccgcttcggc       720
     gatttgggct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page