(data stored in ACNUC7421 zone)

EMBL: CP001600.PE263

CP001600.PE263       Location/Qualifiers
FT   CDS_pept        293003..294322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0290"
FT                   /product="basic amino acid/polyamine antiporter (APA)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67532"
FT                   /db_xref="GOA:C5BCS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS6"
FT                   /protein_id="ACR67532.1"
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   ISYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPATYMANWNTSGGTDYHAVIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVSQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAAIKMTILMVLITVM
FT                   NASGDKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSTQDKDNAPRN"
     atggcttctg taaaaaaaat cgggcttatc gcctgtaccg gggtggttgc cggcaacatg        60
     atgggcagcg gtatcgcgct gctgcccgcc aatctggcaa gcctggggtc aattgccgta       120
     tggggctggc tgatcgcgct ggtgggtgcc gtttctttgg cctatgtgta cgcccgcctg       180
     gccaccaaaa atccccagga gggggggccg gttgcctacg ccggtgaggt cggtgccgcc       240
     ttcgggtttc agaccggggt gctgtactac cacgccaact ggatcggtaa cctggctatc       300
     ggtattaccg ccatctctta tttatctacc ttcttcccgg tacttaatag cccggtaccg       360
     gcggggatcg cctgtatcgc catcgtgtgg attttcacct tcgttaacat gctgggggga       420
     gcctgggtaa gccgcctgac caccctgggg ctggtgctgg tgctgatccc ggttatcggg       480
     accggtattg ccggctggtt ctggtttgag ccggccacct acatggcgaa ctggaacacc       540
     tccggcggta ctgactatca tgcggttatc aagagtatcc tgctgtgcct gtgggcgttt       600
     atcggggtgg agtccgcgtc cgtcagtacc gggatggtga aggatccgca gcgtaacgtc       660
     ccgctggcaa ccatgatggg gacgttcctg gccggtattg tctacattgc ggcgacacag       720
     gccattgccg ggatgtatcc ggcccatcag atggctgcct ccggcgcacc gttcgccatc       780
     agcgcctcaa ccatggtggg cagctgggcc gggccggtgg tgtccgcctt taccgccttt       840
     gcctgtctga cttcgctggg ctcctggatg atgctggtca gtcaggccgg tgcgcgtgcg       900
     gcccatgacg gtaacttccc gaaaatctac ggtgagctgg ataagaatgg cctgccgaag       960
     aaagggctat ttctggccgc gatcaagatg accatcctga tggtgctgat caccgtgatg      1020
     aacgccagcg gcgataaggc ctctgacctg ttcggtgaac tgaccggcat cgcggtgctg      1080
     ttgaccatgc tgccttactt ctactcctgt atcgatctga tccgctttga tggagccaac      1140
     atcaagaatg tgcttagcct gttggcttcc attctcggtt gtgtgttctg ttttatcgct      1200
     ctgatggggg ccaactcgat tgagctgtcc ggtaccttta tcgtcagtct gatcattctg      1260
     atgttctact cacgtaagct gggctccaca caggataaag acaacgcccc gcgtaactaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page