(data stored in ACNUC7421 zone)

EMBL: CP001600.PE266

CP001600.PE266       Location/Qualifiers
FT   CDS_pept        complement(297783..298460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0293"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67535"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS9"
FT                   /protein_id="ACR67535.1"
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKASYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSSGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQSSLQRSSASGTGTSSRS
FT                   MGG"
     atgaaacgga ccaaacacat taatcgcagc gcatttcgca agcgttggca gatggcgccg        60
     ctggcgctgg ctgtcagcgc ggtattcctg ctggccggct gtgaaaagag cgatgaaacg       120
     gtatcgctgt atcaaaacgc cgatgactgc agcaaggcga atccctccat gagcgcacag       180
     tgcaaagcct cttacgacga tgcgctgaaa gaggcggcaa aaaccgcacc gaagtacgcc       240
     acgcgcgagg attgcatcgc cgagttcggc gaaggccagt gtacacagac accggcacag       300
     gctggcatgg caccgacgac gggcaatacc aacgccgaag cggctcagag cagcggcagt       360
     ttctggatgc cgctgatggc cggctacatg atggggcgtc tgatgggcgg cggttttaac       420
     cagcagccgc tgtttacccc gcgcggtgct gccagcccag ccaacggcca gtttgtcgac       480
     gccagcggca agagctatgg cccggccacc gcaggcgggc gtaccatgaa cgtgcctaaa       540
     acagcgatgg cgcccaagcc ggcgaccacc accacggtca cccgcggcgg ctttggcgaa       600
     acggtcgcca agcagagcag cctgcagcgc agcagcgctt ccggcacggg caccagttca       660
     cgcagcatgg gtggctaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page