(data stored in ACNUC7421 zone)

EMBL: CP001600.PE268

CP001600.PE268       Location/Qualifiers
FT   CDS_pept        complement(298789..299358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0295"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67537"
FT                   /db_xref="GOA:C5BCT1"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT1"
FT                   /protein_id="ACR67537.1"
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLTS
FT                   GDALSAMVGILLLLSGIGLIIGMIANRANNFWPMIGGILMGAAYLVMGFIFIRNPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQIIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
     atgatttact tcgatcgcaa ccgtctgttg cagctggatc cgcgcttcct taagcaacag        60
     cgcgtctcac tgctgatcct gtcgctgctg ctgctgctcg gcggtctgtt ctgcctgttc       120
     cgtccgctta cctcaggtga cgccctgagt gccatggtcg gcattctgct gctgctcagc       180
     ggcatagggc taattatcgg catgattgcc aatcgggcca ataacttctg gccgatgatc       240
     ggtgggatat taatgggcgc cgcctatctg gtgatgggct ttatctttat tcgcaacccg       300
     gaggtcggcc tgttcaccgt cgcagtcctg gtcgccaccc tgtttgcgct gggggggatc       360
     gcccgcctga tggccggcgt taagctcaag ggggcccatg gcggctggct gcagatcatc       420
     atcggcctgt tggacctcct gatcgcctgg atgctgataa gtgccgggcc acagggttcc       480
     atactgctgg tcaccatgat cgtcggtatc gaaatgctgt tcagctcttt cagcctgttt       540
     caggtcgccc agctgctgaa gcaacgctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page