(data stored in ACNUC7421 zone)

EMBL: CP001600.PE269

CP001600.PE269       Location/Qualifiers
FT   CDS_pept        complement(299469..299612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67538"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT2"
FT                   /protein_id="ACR67538.1"
FT                   /translation="MREKTPYCLYSRQKILSFHNYALEVTVARTFRLRLHSFFAAWPIM
FT                   DY"
     atgagggaaa aaacgccata ctgcctatac tcccggcaga aaatactatc gtttcacaat        60
     tacgcgctgg aagtcaccgt tgccagaacc tttcgccttc gcctgcactc tttttttgca       120
     gcctggccga tcatggatta ttaa                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page