(data stored in ACNUC7421 zone)

EMBL: CP001600.PE270

CP001600.PE270       Location/Qualifiers
FT   CDS_pept        299761..300678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0297"
FT                   /product="Uncharacterized protein family (UPF0187)"
FT                   /note="Uncharacterised protein family (UPF0187)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67539"
FT                   /db_xref="GOA:C5BCT3"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT3"
FT                   /protein_id="ACR67539.1"
FT                   /translation="MIVRPPQHWFRRLFVWHGSVLPNILFRLSLNFMVSCLAVMCYLWH
FT                   EDFNVNLTLGPFSLLGVAIAIFLGFRNNASYARFIEARVLWGSLLITTRSLMRQAISLM
FT                   PHPDGEHRRFAMLLTAFSYALKHHLRHEPMAMELTRLLPSQDKAAVLGSCSPCNRLLQL
FT                   MGQWLGEQRQRGYLSDIDFQTIDTNLNQLSVILGGCERISNTPIPFAYSLIVHRTVYVF
FT                   CALLPFALVSDLHYMTPLVSVFISYTFIALDALAEELEDPFGIEANDLPLNAMAHTIEA
FT                   NLRDMINDHTHLARICPDSHCRLD"
     atgattgtta gaccccccca gcactggttc cggcgcctgt tcgtctggca cggttcggtg        60
     ttgccgaata tcctttttcg tctcagcctt aatttcatgg tctcctgcct ggcggtgatg       120
     tgctacctgt ggcatgagga ctttaacgtc aacctgacgc tgggtccttt cagcctgctt       180
     ggggtggcca tcgccatctt cctcggcttt cgcaataacg ccagctatgc ccgctttatt       240
     gaggcgcggg tactgtgggg atcgctgctg atcaccaccc gctctctgat gcgccaggcc       300
     atcagcctga tgccgcaccc ggacggcgag caccgccgct tcgccatgct gctgaccgcg       360
     ttttcctatg cgctgaagca ccatctgcgc catgagccga tggccatgga gctgacccgt       420
     cttctgcctt cgcaggataa ggcggcggtg ttggggagct gctccccctg caaccgtctg       480
     ctgcagctga tggggcagtg gctgggagag cagcggcagc gcggctacct gagcgatatt       540
     gacttccaga ccatcgacac caacctgaac cagctgtcgg tgatcctggg gggttgtgag       600
     cggatctcca atacgccgat cccgttcgcc tatagcctga tagttcaccg cacggtgtat       660
     gtgttctgcg cgctgctgcc ctttgccctg gtctccgatc tgcactatat gacgccgctg       720
     gtatccgtgt ttatctcgta taccttcatc gccctggatg ccttggcgga ggagctggag       780
     gatccgtttg gcatcgaggc caacgacctg ccccttaacg cgatggccca tacgatagag       840
     gcaaacctgc gcgatatgat caacgatcat acccacctgg cgcgcatctg ccccgacagc       900
     cactgtcgtc tggattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page