(data stored in ACNUC7421 zone)

EMBL: CP001600.PE271

CP001600.PE271       Location/Qualifiers
FT   CDS_pept        complement(300779..301417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0298"
FT                   /product="chaperone protein TorD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67540"
FT                   /db_xref="GOA:C5BCT4"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT4"
FT                   /protein_id="ACR67540.1"
FT                   /translation="MSAASPLTAQHYACLYAWLAGLFAHETDDAQLARLRSPDTQAWFA
FT                   LLRQLAPLRPALQCLQEALVALEARPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAPCDEVQSLLQRAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPGQEDVLVP
FT                   LRQRTLALLLEWLPEFNARCLRYDTFGFYAALSQLLLALVRLDANHRAA"
     atgagtgccg ccagcccgtt gacggcacag cactacgcct gcctgtacgc ctggctggcc        60
     gggctgttcg cccacgagac agacgacgca cagctggccc gtctgcgctc gcccgacacg       120
     caggcctggt tcgctctgct gcgccagctg gcacccctgc gaccggcgtt gcagtgcctg       180
     caggaggcgc tcgtcgcgct ggaggcacgc ccggacgccc gtctggagct ggcggcagac       240
     ttcgccggtc tgtttttact gtcgcagaag cgggcggcgc tgccctatgc ctcctgctat       300
     cagggggaga ccccgcgctt tcgtcaggcg ccctgcgacg aggtgcagtc cctgttacaa       360
     cgggcgggta tgcagctgaa tgccgacttc cacgaaccgg aggatcatct gtcgatattc       420
     ctggagctgc tcagccacct gagcttcgcc agcgcggagc agccggggca ggaagacgtt       480
     ctggtaccgc tgcggcaacg caccctggcg ctgctgctgg agtggctgcc agaattcaac       540
     gcccgctgcc tgcgctatga cacatttggc ttttacgccg ccctgagtca gctattgctg       600
     gcgctggtgc gtctggatgc caaccacagg gcagcatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page