(data stored in ACNUC7421 zone)

EMBL: CP001600.PE275

CP001600.PE275       Location/Qualifiers
FT   CDS_pept        complement(305967..307001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0302"
FT                   /product="TMAO reductase system periplasmic protein TorT ,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67544"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT8"
FT                   /protein_id="ACR67544.1"
FT                   /translation="MSRRRTLFLCLLWLSTATAHADAPLLRWQSDRQSVQLRQPPLHAG
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFDAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIGVVNALHDPNIRTRIGVPWFQMGYQPGHYLAQ
FT                   HLGQRPLKVLLMPGPRDAGGSREMSDGFKAALGGSRLQIVEVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRSLQGERVPDNISPPILVLTQRNVSSAQVRRSLSPLGFRPVYLYQPA
FT                   LKAG"
     atgtcccgac ggcgcaccct gttcctctgt ctgctttggc tctccaccgc gacggcgcac        60
     gccgatgccc cgctgctgcg ctggcagtcg gatcgtcagt ccgttcagct gcgccaaccc       120
     ccgctgcacg cgggtaagcg ctggaagctg tgcgccctct atcccagcct gaaggatgcc       180
     tactggctct cgatcaacga tgggatgatc cgggccgccg accggctggg cgtgacgctg       240
     aaggtattcg acgccggcgg ctatcgtcag caggcgaccc agcgcgagca gatggccctg       300
     tgccgcgact ggggggccga cgccatactg atcggcagca gcacggcccg cttcccggcg       360
     ctggcgacgc tggccgcggg gatcccgctg atcggggtcg tcaacgccct gcacgatccc       420
     aatatccgca cccggatcgg cgttccctgg ttccagatgg gctatcagcc gggacactac       480
     ctggcgcagc acctcggcca gcgcccactc aaggttttgc tgatgcccgg cccgcgcgac       540
     gccggtggca gccgggagat gagcgatggc tttaaggcgg cgctgggcgg aagccgcctg       600
     cagatcgtgg aggtcgccta cggcgacaat gacatcgagg tgcagcgcaa tctgctgcag       660
     gacatgctgg agcgccatcc ggatatcgac gtggtggccg gtaccgccat cgccgccgaa       720
     gtcgccatgg gcgaagggcg caaccgcgcc acgccgctga ccatcgtctc attctatctc       780
     tcgcaccagg tttaccgtgg tctgaagcgc ggccgcattc tggccgccgc cagcgaccag       840
     atggtgtggc agggcgaact ggccgtcgaa caggccctgc gctcgctgca gggagagcgc       900
     gtgccggaca acatcagccc accgatcttg gtgctcaccc agcgcaacgt cagcagcgcg       960
     caggttcgcc gctcgctctc ccccctgggc tttcgcccgg tctacctcta ccagcccgcg      1020
     ctgaaggcag ggtaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page