(data stored in ACNUC7421 zone)

EMBL: CP001600.PE277

CP001600.PE277       Location/Qualifiers
FT   CDS_pept        309973..310107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67546"
FT                   /db_xref="GOA:C5BCU0"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU0"
FT                   /protein_id="ACR67546.1"
FT                   /translation="MWQLKRALHKKCPRVNIWLVIVFFLLGGGVALALVLYLIASALA"
     atgtggcagt taaagcgggc attacataag aaatgcccgc gggtaaatat ctggctggtt        60
     atcgtgtttt ttttgctggg tggcggtgtt gcactggctc tcgtgttgta tttgatagcc       120
     agtgcattgg cctga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page