(data stored in ACNUC7421 zone)

EMBL: CP001600.PE278

CP001600.PE278       Location/Qualifiers
FT   CDS_pept        complement(310167..311099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0305"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67547"
FT                   /db_xref="GOA:C5BCU1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU1"
FT                   /protein_id="ACR67547.1"
FT                   /translation="MIMDKSVLDESHPNYIGMYNGHLLNPNVREFVESCDCVLKMGTLM
FT                   SDFNTGAFTARLNHQHCITVLPESVLIGTSEYHHVLMKDVLEAVTQKVRRKARPDLAPK
FT                   PQPLAPVSASGAITAPYLYARWQQMLKPHDILVAETGTCSMGLSFVLMPEGATFHNQTL
FT                   WGAIGWATPAALGAAAAAATQRTILISGEGSHQLTVQEISQFARLELKPLIFILNNNGY
FT                   LIERLLCKDGDISYNDLAQWQYHQLPEAMGCKGWFSARVATCEALDAAIRQAEKCDCGA
FT                   YIEVITGKYDASPLAEKMHQSMGSLYQAD"
     atgattatgg ataaaagcgt actggatgag tcacatccta actatatcgg aatgtataac        60
     ggccatctgc tcaaccccaa cgtccgtgag tttgtcgaga gctgcgattg tgtactcaag       120
     atgggtaccc tcatgtctga cttcaatacc ggtgctttta ctgcccggct aaaccaccag       180
     cattgtatta ccgtactgcc ggagtctgtg ctgattggga cctccgaata ccaccacgtt       240
     ttaatgaagg acgtattaga ggccgtcacg caaaaagtac gcagaaaggc ccgcccggat       300
     ttagcgccga aacctcagcc actggcccct gtcagcgcca gtggcgcgat taccgccccc       360
     tatctctacg cacgctggca gcagatgctc aaaccccatg atattttggt cgcagaaacc       420
     ggcacgtgct ctatggggtt aagctttgtc ctgatgccag agggtgccac gttccataat       480
     cagaccctgt ggggagcaat aggctgggcc actccggcag cactgggtgc cgctgctgcc       540
     gctgcgacac agcgaaccat cctcatcagc ggtgagggct cacatcagtt gacggtgcag       600
     gaaattagcc agttcgctcg acttgaactt aagccactga tttttatttt gaataacaat       660
     ggatatttga ttgagcgcct actgtgtaaa gacggggata tctcttacaa cgatctcgcg       720
     cagtggcaat accatcagtt gccggaggcg atgggctgta aaggctggtt cagcgcccgt       780
     gtcgccacct gtgaagcgct ggatgccgcc attcgccagg ctgaaaaatg cgattgtgga       840
     gcctatattg aggtcataac cgggaaatac gacgcctctc ccctggcgga aaaaatgcac       900
     cagtcaatgg ggtcactgta ccaggcagac taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page