(data stored in ACNUC7421 zone)

EMBL: CP001600.PE279

CP001600.PE279       Location/Qualifiers
FT   CDS_pept        complement(312152..313141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0307"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67549"
FT                   /db_xref="GOA:C5BCU3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU3"
FT                   /protein_id="ACR67549.1"
FT                   /translation="MPFIPWVKTTPIHTFFTVVAILILTMIANFKGARITGRISSFTVW
FT                   GIIIPVAGLSIIGWFWFDPQIFSAAWNPHHIGTSKAISSGISLTLWAFLGIESAGANSD
FT                   AVENPERNVPLACLFGTGFAAIVYIASTSVIQGIVPNSQLLASDAPFGLVFTVMFNPVV
FT                   GKVITALAVIACIGSLLGWQFTNAQVSKSAAEMHLFPNIFAKISKDDAPIAGMLIMLAV
FT                   ELVLACMTISPNLLKQFDMLLNLAVFINMVPYVLSMTGLQVMLRKNHVTQSQYYLASIV
FT                   GTVAVVYSIYGIYACGDQAVFGGCIITMFGYIFYGFIAGRDVEMHRTV"
     gtgcccttta ttccatgggt aaaaacaacg cccatacaca ccttctttac cgttgtagca        60
     atcctgatcc tgactatgat tgccaatttt aaaggtgcca gaatcaccgg acgtatctcc       120
     agcttcaccg tttgggggat cattattccg gttgctggcc tgtctattat tggttggttc       180
     tggttcgatc cgcagatttt ttccgccgcg tggaacccac atcacattgg tacctcaaaa       240
     gctatctcct ccggtatttc tcttacccta tgggctttcc tcggtattga gtctgctggc       300
     gccaactctg atgcggtgga aaatcccgag cgaaatgttc cgctagcctg tctgttcggt       360
     actggttttg cagcaatcgt ctatattgcc tcaacctccg taattcaggg tattgttcct       420
     aactcgcaat tgcttgcctc cgatgcaccg tttggcctgg ttttcaccgt gatgttcaac       480
     ccagtggtgg gtaaagtgat caccgccctg gccgtgatcg cctgtatcgg ttcgctcctg       540
     ggctggcagt tcaccaatgc tcaggtatca aagtctgccg ctgaaatgca tttgttcccc       600
     aatatttttg ccaagataag caaagacgac gcgccaatag ccggtatgct gattatgttg       660
     gccgttgaac tggtattggc ctgcatgact atctcgccga acctgctcaa gcagttcgat       720
     atgctactga acctggccgt cttcattaac atggtccctt atgtattatc tatgacgggt       780
     ctacaggtca tgctgcgtaa aaatcacgtc acccaatccc aatattatct ggcctccatc       840
     gtaggtaccg ttgccgtggt atatagcatt tatggtatct atgcctgtgg cgatcaggca       900
     gtcttcggtg gctgtatcat taccatgttc ggctacatct tctatggttt catcgctggc       960
     cgggatgttg agatgcaccg cactgtctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page