(data stored in ACNUC7421 zone)

EMBL: CP001600.PE282

CP001600.PE282       Location/Qualifiers
FT   CDS_pept        315320..315439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67552"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU6"
FT                   /protein_id="ACR67552.1"
FT                   /translation="MTFANHQYRELYLLINIRINEYLSNQDIDFICDAIRHEK"
     gtgacttttg ctaaccatca gtatcgagag ctatatctat tgataaatat tcgcataaat        60
     gaatatttaa gcaatcaaga tatcgatttt atttgcgatg ctatacgcca tgaaaaataa       120
//

If you have problems or comments...

PBIL Back to PBIL home page