(data stored in ACNUC7421 zone)

EMBL: CP001600.PE284

CP001600.PE284       Location/Qualifiers
FT   CDS_pept        317867..318004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67554"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU8"
FT                   /protein_id="ACR67554.1"
FT                   /translation="MSVYAVHEDGEHGPGLKWKIKYSKGVGCYIFIVNHHSCFICFLFG
FT                   "
     atgagcgtat atgcagtaca tgaggatggt gagcacggac ccggactaaa atggaaaatt        60
     aaatattcta aaggggtggg ttgttatatt tttattgtta accatcattc ttgttttatc       120
     tgttttttat ttggttaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page