(data stored in ACNUC7421 zone)

EMBL: CP001600.PE286

CP001600.PE286       Location/Qualifiers
FT   CDS_pept        319468..320340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0314"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67556"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV0"
FT                   /protein_id="ACR67556.1"
FT                   /translation="MKILPVISPKGGEGKSTFAAYLAGFLADAGVKTLLIDADWTQPTV
FT                   SSIFALNKEAPFGLYELLMQTIPDPLQAISQTSIDNLDLIYSNDPDELLPTAMLHAADG
FT                   RIRLRNILQNHEFARYGAIILDSKGATGVMTELSILASTGRVMGVVKPILPDVREFIRG
FT                   SLHMFSRLKTYENYGIHLPDISILVNCFENTLLDREAMDGLSKIISEKLYDSSVLGDRN
FT                   MFSLLDTCIEQLDIFKLGHVKSQPVHRLEYKTRRKGPAAADTMHSLACELFPEWKERFD
FT                   DVLSREVRV"
     atgaaaattt tacccgttat ttccccaaaa ggcggtgaag gtaaatcgac tttcgcggct        60
     tatctcgctg gttttcttgc cgatgctggt gtgaagacac ttcttattga tgcagactgg       120
     actcagccga cggtcagcag cattttcgct cttaataaag aagcaccgtt cgggctgtat       180
     gagcttctca tgcagacgat ccccgaccca cttcaggcta tctctcagac atcaattgat       240
     aatctggatc ttatttactc aaacgatccg gacgaactcc taccgacagc gatgctacac       300
     gcggcagacg gtcgtatccg cttaaggaat attcttcaga atcatgaatt tgcccgctac       360
     ggggcaatta ttcttgactc caaaggtgcc accggggtga tgactgagtt gtccatactt       420
     gcgtcaaccg gccgtgtcat gggagttgtg aaacccatac ttcctgacgt tcgtgagttt       480
     attcgcggtt ccctgcatat gttttcccgc ctcaaaacct acgaaaatta cggcatccac       540
     ctgcccgaca tctctattct tgtgaactgt ttcgaaaata cgcttcttga ccgggaggca       600
     atggacggtc tctcaaaaat tatcagcgag aagctgtatg acagcagcgt gttgggagac       660
     cgaaatatgt tcagtctgct cgatacctgt atcgagcaac tggatatatt caaattgggc       720
     catgttaaat cacagcccgt tcatcggctt gaatataaaa cccggcgtaa ggggcctgcg       780
     gcggcagata ccatgcacag ccttgcctgc gagttgtttc ctgagtggaa agaacgattt       840
     gacgatgttc tctccaggga ggttcgcgta tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page