(data stored in ACNUC7421 zone)

EMBL: CP001600.PE288

CP001600.PE288       Location/Qualifiers
FT   CDS_pept        320690..321487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67558"
FT                   /db_xref="GOA:C5BCV2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV2"
FT                   /protein_id="ACR67558.1"
FT                   /translation="MSYMTINAILAQRPERQPYIDGPEKACCQWQHGVDDRPNNVIVMY
FT                   DEAHGFTVAPVCCRLHTGKSVWRIKPVQFFFNVIPEPCVAGWQIYRPFLCQRNGHFPER
FT                   QFFDIGWQPAVAPDNGIMQGLHGRASVVLNAPVMGPLQPFTQPHQPEFQLPVFRFFLFS
FT                   LTLETLADVVKFTFTHAQKFARQQFAIGIHIFSLCVMNINVLPAPSDQSRQTSWLEIVL
FT                   SVSGIITLAIVCLAPFTFLHGLLVYSAISTVFWQHFHQEVCHG"
     atgagctata tgactatcaa tgccattctg gcgcagcgtc cggagcggca accttatatc        60
     gatggcccag agaaggcgtg ttgccagtgg caacacggtg tggatgacag gcccaataat       120
     gtcatcgtga tgtatgacga ggcacacggc ttcaccgtgg cccctgtatg ttgtcggtta       180
     cacactggca aatcggtatg gcgaatcaag ccagtccagt tttttttcaa cgtaatccct       240
     gagccatgcg ttgcaggctg gcagatatac agaccattcc tctgtcagcg caacggacat       300
     ttcccggagc gtcagttttt cgacatcggc tggcaaccag cggtggcgcc ggataatggc       360
     ataatgcagg gcctgcatgg gcgtgcatct gtggtgctga atgctccagt tatgggtccg       420
     ctgcagccat tcacccagcc acatcagccg gaatttcagt tgccggtctt caggtttttc       480
     ctgttcagcc tcacgctaga aacgctggct gatgttgtca aattcacttt cactcatgcc       540
     caaaaattcg ccaggcagca gtttgctatt ggtattcata ttttttcctt atgtgtaatg       600
     aatataaatg tactgccagc gccttctgac cagagtcgcc aaacatcatg gttagaaatt       660
     gtgctgtcag tatcagggat aataaccctg gcaattgtgt gcctggcacc ctttaccttt       720
     cttcacggcc tgctcgttta ttcagctatt tcaactgtgt tctggcaaca ctttcatcag       780
     gaggtgtgtc atggctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page