(data stored in ACNUC7421 zone)

EMBL: CP001600.PE290

CP001600.PE290       Location/Qualifiers
FT   CDS_pept        322847..324511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0318"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67560"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV4"
FT                   /protein_id="ACR67560.2"
FT                   /translation="MSRNRTNIGASMLQPGRRASGSVESTPVVEMPMVLTIEQLAPNPD
FT                   NPRTSRNSRYDEIKASIKARGLDTVPKVTRDPDGDPNKYIFSDGGNTRYQILTELWQET
FT                   GEERFFRIHVLVKPWPGRLQCVIGHLAENEVRGDLSFIEKAQGIHKARTIYEEQLGKSV
FT                   SLRELSTLLTREGLPVHNSTISRMEDALKHLFPWMPELLESGLGAPQIRLLLALRQDAE
FT                   KVWDQFCLLSERSDKCFTEVFGECCRKFNSPELWSPEMFRDEFIGDLLLALPHPELNYD
FT                   RWMMELDPSERNRRYHFGEPEETTSPQGVVPSPFTDGIQDTAPEPDFALPKALTESPPA
FT                   TPAVTEEWPQQDENLRVSPEDNKEAPLSLPRTEVQPDMYGGSPVISGDGMGPGLSPDND
FT                   ETLISMLAPGLEDEGEALHPACHIAGDAIWSVPAYQDDIEHLQNIAFIMAWELGEKLGC
FT                   EDEILPDRASSLSPGYCAAGDSCSAPAAFLLSLAGCCPAQCPTTGMDVVLIGGSAQQDV
FT                   PVLDDENAIKLLRLMRVMRRLRELQRGVTAVEDEHDE"
     atgagccgta accgcacgaa tattggggcc tctatgctcc agccgggccg cagggcctca        60
     gggagcgttg agagtacacc ggtggttgaa atgccaatgg ttctgacgat tgagcaactg       120
     gcaccaaacc cggataaccc ccgaacatcg cgtaattcac gctatgacga gataaaggcg       180
     tcaattaagg cccgcgggct ggatacggtg ccgaaagtca cccgcgatcc ggatggtgac       240
     ccgaataaat acattttcag tgatggtggt aacacccgtt atcagatact gacagagctg       300
     tggcaggaaa cgggggaaga gcggtttttc cgcatccatg tactcgtgaa gccctggcct       360
     gggcggctcc agtgtgtgat tggtcatctc gcggagaatg aggttcgtgg cgatctgtcc       420
     tttattgaaa aggcccaggg gatccataaa gcgcggacta tttatgagga acaactggga       480
     aagtcagttt ctctgcgcga attatccact ttactcactc gtgaaggtct gcctgtccat       540
     aattcgacaa ttagccggat ggaagatgcc ctgaagcacc tctttccctg gatgccggag       600
     ctgcttgagt ccgggcttgg cgcaccacaa atcaggctgt tactcgcttt gcgccaggat       660
     gctgagaaag tctgggatca gttttgcctt ctgtctgaac gaagcgataa atgcttcacc       720
     gaggtatttg gtgaatgctg ccgcaagttc aattcccccg aactgtggtc accggaaatg       780
     ttccgcgatg aatttattgg tgatctgctg ctggcgctac cgcatccgga gctgaattat       840
     gaccgctgga tgatggagct ggatcccagt gagcgtaacc ggcgctatca ctttggcgaa       900
     ccggaggaga ctaccagtcc tcagggagtg gtgccatcac cgttcactga cggcattcag       960
     gatactgcac ccgagccaga ttttgccctg ccgaaagcac taactgagtc gccgcctgcc      1020
     acgccagcgg ttacggagga atggccgcag caagatgaaa atttacgggt atcgccagag      1080
     gacaataaag aggcaccttt gtctcttccg cgcacagagg tacagcccga tatgtacggt      1140
     ggttccccgg ttatttcggg tgacggcatg gggccggggc tttctccgga caatgatgag      1200
     acgcttatct ccatgctggc gccggggctg gaggatgagg gagaggccct gcatccggcc      1260
     tgtcacattg ccggagatgc gatctggtct gttccggctt atcaggatga tatcgaacat      1320
     ctgcagaata tagccttcat catggcgtgg gaactggggg aaaagctggg gtgtgaagat      1380
     gaaatcctgc cagaccgcgc cagtagtctg tcgccaggct attgcgctgc gggtgacagc      1440
     tgcagcgcac cggccgcctt ccttttgtcc cttgcggggt gttgtccggc acagtgtccg      1500
     acaaccggga tggatgttgt gctgatcggc ggttctgcac agcaggatgt gccagttctt      1560
     gatgatgaaa atgccataaa actgctgagg ctgatgcgtg tcatgcgccg cctgcgggag      1620
     ctgcagcgtg gcgtaacggc ggtagaggat gagcatgatg aataa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page