(data stored in ACNUC7421 zone)

EMBL: CP001600.PE291

CP001600.PE291       Location/Qualifiers
FT   CDS_pept        324504..325226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0319"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67561"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV5"
FT                   /protein_id="ACR67561.1"
FT                   /translation="MNNDKRQERLVSLVRKLLELSRSNSNAHEAGLALSRAQRLMEKYG
FT                   ISELDATLSSVRDVASQSAPSEAEKVPEWMTRLAWAVGHAFGCRPYFSWRNTSSGDCRQ
FT                   TVTFYGFSERPAVAAYAFDVLTRQLKDATAVYLKTQSKKLKLSTRRNRAELFRAGWVDG
FT                   MRRVITVFRVTERETQLMTRWMDNQNMKAATIRELKSCRGGDIARHRGYEAGKNARLHH
FT                   GVEGENTAAIGHREERTS"
     atgaataatg acaaacgcca ggagcggctg gtcagtctgg tcaggaaact gctggaactg        60
     agccgaagca acagcaatgc gcatgaagcc ggactggcgc tttcaagggc gcagcgcctg       120
     atggaaaaat atggtatcag cgagctggac gccactcttt cgtcagttcg tgacgttgcc       180
     tctcagagcg cgccatcaga ggccgaaaag gtgcctgagt ggatgacccg tctggcatgg       240
     gcggttggtc atgcctttgg ctgtcggcct tacttctcat ggcgcaatac atcatcgggc       300
     gactgtcgac aaaccgtaac attttatggt ttcagtgaac ggcctgccgt ggcggcttat       360
     gcttttgatg tgctgacccg ccagttgaaa gatgccactg cggtatacct gaaaacccag       420
     agtaaaaagc tgaagctgtc gacccgcaga aaccgggcag agctttttcg tgccgggtgg       480
     gttgacggca tgcgtcgcgt catcacggtt ttccgggtta cagaacggga aacgcaactg       540
     atgacccgct ggatggataa ccagaatatg aaggcggcga ccatccggga actgaaaagc       600
     tgccgcggag gcgatattgc ccgccaccgg ggttatgagg cgggtaagaa cgccaggttg       660
     catcatggtg ttgaaggtga aaatacggcc gccattggtc accgggagga acgtacgtca       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page