(data stored in ACNUC7421 zone)

EMBL: CP001600.PE292

CP001600.PE292       Location/Qualifiers
FT   CDS_pept        325223..325648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67562"
FT                   /db_xref="GOA:C5BCV6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV6"
FT                   /protein_id="ACR67562.1"
FT                   /translation="MTKHQRVLLSGTSHCLWCGVVLGLLAADMYPGVVPAFSGAVLRGL
FT                   AVASFISVLLWMMVSYLEDISWTYIWGVMFLPPLAALLLCHVGWLGYSFIFWKWDYDFA
FT                   LFIREAVLPVVFLVWGACNFLIVPFIFLFILSPGGVE"
     atgacgaagc atcaacgggt gttgctgtcg ggtacctccc attgtctgtg gtgcggtgtg        60
     gtactggggc tgctggccgc agatatgtat cccggtgtcg ttccggcatt ttccggggcc       120
     gttttacggg ggctggctgt tgccagcttc atttctgtcc tgctgtggat gatggtgagc       180
     tacctggagg acatttcctg gacgtatatc tggggggtga tgttcctgcc tccgctggcc       240
     gcattactcc tctgtcatgt gggctggctg ggttacagct ttattttctg gaaatgggac       300
     tatgattttg ctctcttcat ccgggaggcg gttctgccag ttgttttcct tgtgtgggga       360
     gcatgtaact tcttaatagt cccctttatc tttttgttta tcttgtctcc cggaggtgtt       420
     gagtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page