(data stored in ACNUC7421 zone)

EMBL: CP001600.PE293

CP001600.PE293       Location/Qualifiers
FT   CDS_pept        325645..326253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0321"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67563"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV7"
FT                   /protein_id="ACR67563.1"
FT                   /translation="MTNSGGLSQAANGLLMQLVMDLKSGYLRRCESLGIKREEMQMLQG
FT                   LSLEELHYLANSEVSVVSISIDHSNLVSMLQRARMEQKRMQRIDRALALGSSIELMQTF
FT                   FGLSSTDVAARRRIAGIEARSGRGNTLGDEDNAEIWRLWQKSGVEEVESPDGLDVMMLA
FT                   AEQLNIPLTSVWHAVKGWHRTTPRRSVGQSLKPSVRKRA"
     gtgactaatt ccggtggttt atctcaggct gccaacgggc tgctgatgca gctggtgatg        60
     gatctgaaaa gtggctatct ccgtcgctgt gagtcgctgg ggatcaagcg agaagagatg       120
     cagatgttgc agggactctc ccttgaggag ctgcattatc tcgcgaacag cgaagtttct       180
     gtggtcagca tcagcatcga tcacagcaat ctggtcagca tgctgcaacg ggccagaatg       240
     gagcaaaagc gcatgcaacg catcgaccgg gcgctggcgc tgggcagttc gatagagctg       300
     atgcagacat ttttcgggct ttccagtaca gatgtggcgg cccgtcgcag gatcgccggt       360
     atcgaagccc gatccggacg gggcaatacg ctcggggatg aagacaatgc agaaatctgg       420
     cggctgtggc agaaatcagg cgttgaagaa gtggaaagcc cggacgggct ggacgtcatg       480
     atgctggccg cagagcaact gaatatccct cttacctctg tctggcatgc tgtgaaagga       540
     tggcacagaa ccacaccccg ccggtctgtg ggtcagtccc tgaaaccctc agtgaggaag       600
     cgtgcatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page