(data stored in ACNUC7421 zone)

EMBL: CP001600.PE294

CP001600.PE294       Location/Qualifiers
FT   CDS_pept        326537..327757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0322"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67564"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV8"
FT                   /protein_id="ACR67564.1"
FT                   /translation="MMLPADSLIAFTLEKMNARLVANPLRDAGRVRSGLLFTGNVHDAI
FT                   PRRLLLDPRLSPLDKMGWMMIRLYAQNNEGAIFPSYDELQLQLASPGKGKASRETVSRV
FT                   LLMLRITGWLSLCRRVRDDKGRVRGNIYAQHDEPLTFRDAESLDPRFLDVVADACLSKN
FT                   RTVSQTARGVLDEIKTDPTMRHYHSHLSLLENRLGRPQNAGQLATRQHPSLLTPEQGSG
FT                   SELSVNRTINDHHELSTETELSQNQERIIQSSDSELPVKSGDYDRVRKPNHYVRSFTHS
FT                   VNKKTYVDNPVVLPDALKAVVSQEDQVMLIRQLQALPEELALQVLSALQSQMARRQVDN
FT                   PLGWMLAVMKKAREGAFRPVKQPHPVQFETHEQPLFSASPRPAAASEEQVRNYVNTLRE
FT                   QLRQNTR"
     atgatgctgc ctgcggatag tttgatagcg tttacgctgg aaaaaatgaa tgcccgtctg        60
     gtggctaatc cactgcgcga tgccggacgg gtacgcagcg gtctgctgtt tacggggaat       120
     gtgcatgatg ccatcccccg aagactgttg ttggatccgc gactttcccc ccttgataaa       180
     atgggctgga tgatgatccg cctgtatgcg cagaataatg agggtgcgat attccccagt       240
     tatgatgagc tgcagctgca gctggcttct ccgggtaaag gtaaagcctc tcgtgaaacg       300
     gtcagccggg tgttactgat gttacgaata accggctggc tcagtctctg caggcgagtt       360
     cgtgatgata aagggcgggt tcgcggcaat atctacgcgc agcatgacga gccactgact       420
     ttccgggatg cagaatcact ggacccgcgt tttcttgatg ttgttgccga tgcttgcctg       480
     agtaaaaacc ggacggtcag tcagaccgcc cggggtgtgc tggacgagat taaaaccgat       540
     cccacaatgc ggcactacca tagccacctg tctcttctag aaaaccgcct gggtcggcca       600
     caaaatgccg gtcagttagc cacgcggcag catccttcat tattaacccc ggaacagggt       660
     tcgggatccg aactcagtgt aaatagaaca ataaatgacc atcacgaact gagtacggaa       720
     accgaactca gtcagaatca ggagcgaata atacagagtt cggattccga actaccagtg       780
     aaatcagggg attatgacag agttcggaaa ccgaaccatt acgtacgtag tttcacacac       840
     agtgtgaata aaaaaacgta cgtagacaat ccggtagtgc tgcctgatgc gctgaaagcc       900
     gtagtgtcgc aggaagacca agtgatgctg attcgtcagc ttcaggccct tccggaagaa       960
     ctggcactgc aggttctgtc tgccctgcag agccagatgg ccaggcggca ggtggataat      1020
     ccgcttggct ggatgctggc agtgatgaaa aaagcccgcg agggggcctt cagaccggtt      1080
     aaacaaccgc atcctgttca gtttgagact catgaacagc cgcttttctc cgcgtctcca      1140
     cgacctgcgg cagcgtctga ggagcaggtc agaaactacg tgaacactct tcgggagcaa      1200
     ctgcgacaaa atacccgatg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page