(data stored in ACNUC7421 zone)

EMBL: CP001600.PE295

CP001600.PE295       Location/Qualifiers
FT   CDS_pept        327765..328916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0323"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67565"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV9"
FT                   /protein_id="ACR67565.1"
FT                   /translation="MCSVASSNSGTKNVRCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQ
FT                   WLKNAQCWRCQQRLKNAQRWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQ
FT                   QWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRC
FT                   QQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWR
FT                   CQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCW
FT                   HCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQC
FT                   WHCQQRLKNVLCLLAMDKSKFHHLAIWFSIVLLPLAADYLNPD"
     gtgtgcagtg ttgccagtag caacagtggt acaaagaatg tacggtgctg gcactgccag        60
     cagtggttaa aaaacgcaca gtgctggcac tgccagcagt ggttaaaaaa cgcacagtgc       120
     tggcactgcc agcagtggtt aaaaaacgca cagtgctggc gctgccagca gcggttaaaa       180
     aacgcacagc gctggcactg ccagcagcgg ttaaaaaacg cacagtgctg gcactgccag       240
     cagtggttaa aaaacgcaca gtgctggcac tgccagcagt ggttaaaaaa cgcacagtgc       300
     tggcactgcc agcagtggtt aaaaaacgca cagtgctggc actgccagca gtggttaaaa       360
     aacgcacagt gctggcactg ccagcagtgg ttaaaaaacg cacagtgctg gcactgccag       420
     cagtggttaa aaaacgcaca gtgctggcac tgccagcagt ggttaaaaaa cgcacagtgc       480
     tggcgctgcc agcagcggtt aaaaaacgca cagtgctggc actgccagca gcggttaaaa       540
     aacgcacagt gctggcactg ccagcagtgg ttaaaaaacg cacagtgctg gcactgccag       600
     cagtggttaa aaaacgcaca gtgctggcac tgccagcagt ggttaaaaaa cgcacagtgc       660
     tggcgctgcc agcagcggtt aaaaaacgca cagtgctggc actgccagca gtggttaaaa       720
     aacgcacagt gctggcactg ccagcagtgg ttaaaaaacg cacagtgctg gcactgccag       780
     cagtggttaa aaaacgcaca gtgctggcgc tgccagcagc ggttaaaaaa cgcacagtgc       840
     tggcactgcc agcagtggtt aaaaaacgca cagtgctggc actgccagca gtggttaaaa       900
     aacgcacagt gctggcgctg ccagcagcgg ttaaaaaacg cacagtgctg gcactgccag       960
     cagcggttaa aaaacgcaca gtgctggcac tgccagcagt ggttaaaaaa cgcacagtgc      1020
     tggcactgcc agcagcggtt aaaaaatgtt ctgtgcttac tggcaatgga taaatcaaaa      1080
     tttcatcatc tggcgatctg gttttcaatt gtcctgcttc ctcttgctgc ggactatctc      1140
     aatcctgact ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page