(data stored in ACNUC7421 zone)

EMBL: CP001600.PE296

CP001600.PE296       Location/Qualifiers
FT   CDS_pept        328943..329698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0324"
FT                   /product="Protein of unknown function (DUF1845)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67566"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW0"
FT                   /protein_id="ACR67566.1"
FT                   /translation="MEKGKKNADAKVGNEASSPRAGALQSALSVELHTHYASRLWEGRK
FT                   QSDSDSRSHHEKKRPEIISMPKAIQRAGIASRDSASDNPYADAVLLKLENAINAASTKV
FT                   SKTLNELDAILGGVPNGITLSDIASAHPLNISIYSRSPLGYRCVWLLVGYDQLAMKAFQ
FT                   AFHYGLISRAQRDQYLNRGGHAVRQVYGAIQPYYTVTVNRSDIINLTARGQEALARLGE
FT                   PDPDIFSGKKRSSFSSPLREKPVSQSEKS"
     atggaaaagg gtaaaaagaa cgcggatgct aaggtcggta atgaagcatc ttcaccgcgg        60
     gcaggcgcat tacagtctgc gctttcggtg gagcttcata ctcactatgc cagcagatta       120
     tgggaagggc gtaagcaaag tgacagcgat tcccgtagtc atcatgagaa aaaacggcct       180
     gaaatcatca gtatgccaaa ggctattcaa cgtgctggaa tagcgtcccg agattcagca       240
     tcagataatc cgtatgctga tgcggtacta ttgaaactgg aaaatgcgat taatgcagca       300
     tccaccaagg tcagtaaaac gctcaatgag ctagacgcga ttctcggtgg cgttcccaac       360
     gggataacgc tttctgacat tgcgtctgcg catcctctga atatcagcat ttacagccgt       420
     tctcccctag gttaccggtg cgtatggctg ctggtcggtt acgaccagct ggcaatgaaa       480
     gcgtttcagg ctttccatta tgggctgatc tcacgcgctc agcgcgatca gtatctcaac       540
     agaggtggac atgctgtcag acaggtttat ggcgctattc agccttatta caccgtgacg       600
     gtcaaccgga gcgatattat taatctgacc gcccgcgggc aagaggctct ggcgcggctg       660
     ggtgaacccg accccgatat tttctccggt aaaaagcgat cttctttttc atcgcctctg       720
     cgggaaaaac ctgttagcca gagcgaaaag agctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page