(data stored in ACNUC7421 zone)

EMBL: CP001600.PE3

CP001600.PE3         Location/Qualifiers
FT   CDS_pept        2653..3729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0003"
FT                   /product="DNA replication and repair protein RecF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67265"
FT                   /db_xref="GOA:C5BHC7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHC7"
FT                   /protein_id="ACR67265.1"
FT                   /translation="MALTRLVIRDFRNIEEADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCSAFVLHGRIDDGGGRERAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGERSFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTAQGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKSTGAQVFVSAVNADQIGD
FT                   MVDEKGKMFHVEQGKIAV"
     atggcattga cccgtctggt gatccgtgat tttcgtaata tcgaagaggc tgatctcgcg        60
     ttggcccctg gatttaattt tttggtcggc gccaacggca gtggaaagac cagcgtgctg       120
     gaggctatct atacgctggg gcacgggcgg gcgtttcgca gcctacaggc cgggcgggtg       180
     atccgtcacg actgctctgc gttcgtgttg catggccgca ttgatgacgg tggcgggcgg       240
     gagcgggcgg tcgggctgag caaggatcgc cagggggaca gcaaggttcg catcgacggc       300
     agcgacggcc ataaagtggc tgagctggcg cagatgctgc cgatgcagct gatcaccccg       360
     gagggattca ccctgctcaa tggcggacct aaataccggc gggccttcct ggactggggc       420
     tgttttcacg gagagcggag cttttttacc gcgtggaaca atctgcggcg ggtgttgaaa       480
     cagcgtaacg ccgcgctgcg tcaggtgacg cgctatgccc aaatccgccc ctgggatcag       540
     gagctggtgc cgctggccga acaggtcagc gcgctgcggg cggcctacag tgaggctatc       600
     gcccaggaca ttgcggcgac ctgcagccag tttttgccag agtatgcgct ctccttttcg       660
     tttatgcgtg gctgggatcg cgagagcgat tatgcagcgc tgctggagcg tcactttgag       720
     cgcgatcggg cgctgaccta taccgcacag gggccgcaca aagcggactt ccgtatccgc       780
     gccgacggta cgccggttga ggatttgctg tcgcgtgggc agctaaaatt gttgatgtgc       840
     gcgctgcgcc tcgcacaggg ggaatacctg acgcgccaca gcggccgtca gtgtctgtat       900
     ctgatcgatg acttcgcctc tgagctggat gccgggcggc gccgtttgct tgccgaacgg       960
     ctgaaatcca ccggcgcaca ggtgtttgtc agcgcggtca atgccgatca gatcggcgac      1020
     atggttgatg aaaagggcaa gatgttccac gtggaacaag gtaaaatagc cgtttag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page