(data stored in ACNUC7421 zone)

EMBL: CP001600.PE300

CP001600.PE300       Location/Qualifiers
FT   CDS_pept        333926..334189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0329"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67571"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW5"
FT                   /protein_id="ACR67571.1"
FT                   /translation="MLTLQSENDIRVMNVCIDDDRLTVDLMDGRSISVPVAWFPRLAAG
FT                   TAEQRQNWELCGAGYGIHWPELDEDLSTEGLLRGAKGATPRH"
     atgcttactt tacaaagtga gaatgatatt cgcgtaatga atgtctgtat tgatgatgat        60
     cgcctgacgg ttgatctcat ggatggacgc agtatctctg ttcccgttgc ctggttcccg       120
     cgtcttgctg ctggtactgc tgagcagcga caaaactggg agctgtgtgg tgctggttat       180
     ggtatccact ggcctgaact ggatgaggac ctgagtaccg aagggctgct tcgtggtgct       240
     aaaggtgcga ctccgcgaca ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page