(data stored in ACNUC7421 zone)

EMBL: CP001600.PE301

CP001600.PE301       Location/Qualifiers
FT   CDS_pept        334331..334927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0330"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67572"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW6"
FT                   /protein_id="ACR67572.1"
FT                   /translation="MKFYTRSKTLTAVLPLLLLAGCSSSPQKLQQRDAAVPTPSVAVTR
FT                   NVQTVAPDEYARMPEVVRYDRYLLVSTDPMAVQRDPLSQIIDIRIPAALHPTVADALRY
FT                   ALKQSGYSLCAMGPANGVLYRQPLPAVQYQLGPMRLRTALQVMAGPAWQLEVDDVQRVA
FT                   CHSLRDGYQLPASQLPPVLTSAKVPAPVKGGFLKK"
     atgaaatttt atacccgtag taagaccctt actgctgttc tgccgctact tttgctggcc        60
     ggctgttcct cttcacctca gaaactacag cagcgtgatg ccgctgtgcc cacgccttcc       120
     gtggctgtca ctcgcaatgt tcagaccgtc gcacctgatg aatatgcccg aatgccggag       180
     gtggtgcgtt atgaccgtta cctgttggtc agcacggatc cgatggctgt ccagcgtgat       240
     ccgctgtccc agattattga tatccgtatt ccggcagcac tgcatccgac agtggcggat       300
     gccctgcgct atgccctgaa gcagtccggc tattcgcttt gcgccatggg accggcaaac       360
     ggcgtgctgt atcgccagcc actgccggcc gtgcagtatc agttggggcc catgcgcttg       420
     cgtacggctc tgcaggtgat ggccggtccg gcctggcaac tggaggttga tgatgttcaa       480
     cgtgtggctt gtcacagttt gcgtgatggg tatcagttac cggccagcca gttaccgcct       540
     gtgctgacgt ccgccaaggt acctgccccg gttaagggag ggtttctgaa aaaatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page