(data stored in ACNUC7421 zone)

EMBL: CP001600.PE302

CP001600.PE302       Location/Qualifiers
FT   CDS_pept        335047..335646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0331"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67573"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW7"
FT                   /protein_id="ACR67573.1"
FT                   /translation="MLVNGVTDLDTRLSHLEAQDNTAKTTATLSSLQSQISTLQAGLAD
FT                   NQQRVTTLQKEIETRTAPSQALTTLQASAARLQQVQQEMEARLTTLVNQLNTLKTAPAA
FT                   AIPASEKTPTDVKKPLPVKPRTTAAVARHAPFVLTGVERRGAESWAAVAPRGYHSLSQI
FT                   ALIGEGETVSGWTLVRAGYSEATFRVNGRLIALKVE"
     gtgctggtca acggtgtgac tgacctggat acacgtcttt cacacctcga ggcgcaggac        60
     aataccgcca aaaccaccgc gacgttatcc tcccttcagt cgcagatttc gacgttacag       120
     gccgggcttg ctgataacca gcagcgtgtg actacgttgc agaaagagat tgaaacccgg       180
     acggccccct cgcaggcact gaccactctg caggcgtctg ccgcacggtt gcaacaggtg       240
     cagcaggaga tggaggctag gcttaccacg cttgttaatc agttgaatac cctgaaaaca       300
     gcaccagctg ctgcgatccc tgcctcggaa aaaacaccga cagacgtcaa aaagcctcta       360
     cctgttaaac cccgaacgac ggctgctgtt gcacgtcatg cgccgtttgt gctgaccgga       420
     gtggaaagac gaggcgcgga gtcgtgggcg gcggtggcac cccgcggtta ccacagcctg       480
     tcgcagatag cgcttatcgg agaaggggaa actgtctccg gctggacact ggttcgtgct       540
     ggttacagcg aggcgacttt ccgtgtcaac gggcgtctga tcgcccttaa ggtggagtaa       600
//

If you have problems or comments...

PBIL Back to PBIL home page