(data stored in ACNUC7421 zone)

EMBL: CP001600.PE303

CP001600.PE303       Location/Qualifiers
FT   CDS_pept        335653..336357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0332"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67574"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW8"
FT                   /protein_id="ACR67574.1"
FT                   /translation="MQLQLTFLALIMLSSQALAATDTSVVENSQTTQSQMQALQQKAGE
FT                   WGLSPEDYQRYQQLMDGPRGIQSPGLDPLSALGIEARTPAERRQYAEKWVKEEFARTQK
FT                   ELDFQREINAAWQRLYPDRLPVNLGNVAGVSRDTGGRLALFVKSKDCPTCDARLSAVLS
FT                   DNRPIDIYLVDSEGSDDMLRQWARTHRIPAEKVRSRQITLNHDGGRWLRFGNGMMPVLL
FT                   QQGEDGWHIAAF"
     atgcaactgc aactgacctt tttggcgttg atcatgctga gctctcaggc tctggcggcc        60
     acggatacct ccgtagttga aaattcgcaa accacacaga gccagatgca ggccctgcag       120
     cagaaggccg gagagtgggg actcagcccg gaggattacc agcggtatca gcaactgatg       180
     gatggccccc ggggtatcca gtccccgggg ctggatccgc tgtcggcgct agggattgag       240
     gcccgcacac cggcagagcg ccgtcagtat gcggaaaaat gggttaaaga ggaatttgcc       300
     cgtacgcaaa aagaactgga tttccagcgg gaaatcaatg cggcatggca acggctttat       360
     ccggatagac tgccggtgaa tctggggaat gttgccggtg tttcccggga taccgggggg       420
     cgtctggcgt tgttcgttaa gtcgaaagac tgtccgacct gcgatgcgcg gctgtctgca       480
     gtactcagtg ataatcgtcc gattgatatt tacctggtcg acagtgaggg gagtgatgac       540
     atgttacgcc agtgggctcg cactcaccgt atcccggcgg aaaaagtccg ttcccgacag       600
     attacgctga accatgacgg tgggcgctgg ttgcgtttcg gcaacggaat gatgccagtg       660
     ttattgcaac agggggagga tggatggcat atcgccgcat tctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page