(data stored in ACNUC7421 zone)

EMBL: CP001600.PE304

CP001600.PE304       Location/Qualifiers
FT   CDS_pept        336546..337001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0333"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67575"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW9"
FT                   /protein_id="ACR67575.1"
FT                   /translation="MARPWPWTINVAGKEYRYSSRLEAWQALQVFMSRYSLKRIDVGLA
FT                   QVNLGWNGHHFTSTWAAFDPYTNLNAAAAILRECWERKPGSWLDAAGCYHHPAGGQAAV
FT                   RYKTIVKRHLVRISGSIRQSPPPLLPQTIVANAPEPGFIWTEPGSEP"
     gtggcccgtc cctggccgtg gacgattaac gtggcaggta aggaataccg ctacagtagt        60
     cgtctagagg cctggcaggc gctgcaggta tttatgtcac gttattccct taaacgtatt       120
     gatgtcggtc tggcgcaagt gaatctgggc tggaatgggc atcactttac ctcgacctgg       180
     gcagcattcg atccgtacac caacctcaac gctgctgcgg ccatcctgcg cgagtgttgg       240
     gagcgtaaac cgggtagctg gctggatgcg gccggttgct atcaccatcc ggcgggaggg       300
     caagcggcag tacgatacaa aactattgta aaacgtcatc ttgtccgtat cagcggctcg       360
     atccgccagt ctccgccccc tttattaccg caaacaatag tggccaatgc ccctgagcct       420
     ggttttatct ggactgaacc tgggagtgag ccctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page