(data stored in ACNUC7421 zone)

EMBL: CP001600.PE305

CP001600.PE305       Location/Qualifiers
FT   CDS_pept        337001..337513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0334"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67576"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX0"
FT                   /protein_id="ACR67576.1"
FT                   /translation="MKKLLLMICLFLPLMGYAGLNVIADLGGEDASPYFDGINKQPDLL
FT                   EASTATTLPPVSDMAAMFPVSTPEMAPGVVADRPLQLPGIGALFLIGDDVLSRSWLAEN
FT                   AQTLTDRHAVGMIISVDSASAVQSLRSLAPGVPMAPASGSELARRLQLRHYPVLISDTG
FT                   LSRQVRP"
     atgaaaaagc tgcttttaat gatatgtctc ttccttcccc tgatgggcta tgccgggttg        60
     aatgttatcg ctgatctggg aggggaggat gcctcgcctt actttgatgg tattaataaa       120
     caacccgacc tactggaggc gtcgacagca accacactgc caccggtttc tgatatggct       180
     gcaatgtttc cggtcagcac gccggagatg gcgccagggg tggtggcgga tcgtccgttg       240
     cagttgccgg gcataggtgc gcttttcctg atcggtgacg acgttctgtc gcgatcctgg       300
     ctggcggaga acgcgcagac gctgacggac cgacatgcgg tcggcatgat tatcagtgtt       360
     gacagcgcgt cggcagttca gtcattgcgc tccttggctc ctggcgttcc gatggcaccg       420
     gcatccggct ctgagctggc ccgccggttg cagttgcggc attacccggt tctgatctca       480
     gataccggat tgtcccggca ggtacggcca tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page