(data stored in ACNUC7421 zone)

EMBL: CP001600.PE306

CP001600.PE306       Location/Qualifiers
FT   CDS_pept        337554..338474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0335"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67577"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX1"
FT                   /protein_id="ACR67577.1"
FT                   /translation="MASLAVGGCVYRCNAVFKLSSTGKGLRSSSGAVFVSSGRKIMSDL
FT                   YLVEADNGCSFTDRVNRNLPAWAEHQIKAWDLTAFQQAEDFMTHHYWTDKGSINVFRIV
FT                   GTDHPQYAGMTWSELLQRGKRMDINIPLIEKKPEYYTDASVLHTSMSYVSLDGIHWYIS
FT                   ADGNHRSCLARFYFHLLGHSVTQLHNVSLSQYRADTVFMSACQDVLRLAPALRQKGVYL
FT                   TLTAHRLPVSREDTPGWKLDTFKTQVSVILDNVASDDDIRTFELHSATQAQHLLRQLES
FT                   ELMQPAVASAAPWWKRLLPFRREGV"
     atggccagtc ttgctgttgg cgggtgtgtt tatcgttgta atgctgtgtt taagctttcg        60
     tcaacgggaa aaggcctgcg ttcgtcgtca ggggcggtgt tcgtgtcgtc agggaggaag       120
     ataatgagtg atctctattt ggttgaggct gataacggtt gttcatttac cgaccgggtg       180
     aacaggaact tgcccgcttg ggcagaacat cagattaaag cctgggatct tactgcattc       240
     cagcaggctg aagactttat gacacatcat tactggaccg ataagggcag tattaacgtg       300
     tttcgtattg tagggacgga ccacccgcag tatgccggca tgacctggtc tgagcttttg       360
     cagcgcggaa agcgaatgga tatcaacatt ccgctgattg aaaaaaaacc ggagtactat       420
     accgatgctt ctgtgctgca taccagtatg agctatgtca gtctggacgg tattcactgg       480
     tatatcagtg cagatggtaa tcaccgcagt tgcctggccc gtttttattt tcatctgttg       540
     ggtcattccg tgacgcagtt gcacaatgtt tccctgagtc agtaccgggc tgatacggtc       600
     tttatgtcgg cctgtcagga tgtcttgcgg ttggcaccag cactgaggca gaagggggtt       660
     tatctgaccc tgacagccca tcgcctgccc gtgtcgcggg aagacacgcc gggctggaag       720
     ctggatacgt tcaaaacaca ggtgtccgtc attctggata atgttgccag cgatgatgat       780
     atccggacat ttgagttaca cagtgccaca caggcgcagc acttgcttcg ccaactggaa       840
     agcgagttga tgcagccggc ggttgcttca gccgccccct ggtggaaacg tctgttgcct       900
     tttcgtcggg agggagtatg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page